... Change password . Please enter the checkword and your new password . Login . Checkword . New password Confirm password . Recover password . ... Please log in. ... Password . ... Forgot password? Password request . Send me checkword . ... E-mail . ... If you cannot remember your password, enter your login or e-mail you have used for registration. A message containing the check word you can use to change the password will be sent to your e-mail. ... One-time password . ...

Еще в разделе: (Показать все результаты (>5) - www.ffl.msu.ru/ )

• Get Password - Факультет иностранных языков
• Authorization - Факультет иностранных языков

... Форумы > Разное > Тема > Страница 4 . Автор темы ken . Форумы Список тем Новая тема . ... THE WHITE MAN'S BURDEN . Take up the White Man's burden-- . ... Ответить Цитировать . ... Страницы: 1 2 3 4 Следующая тема Предыдущая тема . ... Извините, только зарегистрированные пользователи могут публиковать сообщения в этом форуме. ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>149) - www.mmonline.ru/ )

• MMOnline | Форумы | Аспирантура | PhD position in the University of Florida
• Математический семинар Глобус, заседание 21 декабря 2006 г.
• MMOnline | Новости | Заседание Московского Математического Общества 11 октября

by Margarita Dzhalalova It is known that the pressure difference values for a round parachute are constant over total canopy, then for a square parachute the values of pressure difference are non-uniform along radial ribbons differing even from each other and depending mainly on certain sets of line lengths, and therefore square parachutes attain different shapes from each other ( Fig.1 - photo of var.1 and var.2). ... Distribution of pressure coefficient along radial ribbons of square parachute. ...

Еще в разделе: (Показать все результаты (>8) - margaret.imec.msu.ru/ )

• Scientific Achievements
• Parachute Equipment
• teachers

... Mathematical Theory of Feedback Control . ... Annotation: this course is about mathematical equations of atmospheric diffusion which allow modeling of the problems of environment. ... The course reflects the experience and the point of view of a research group in the field of mathematical modeling of Western, Soviet and later Russian economics. ... Such approach captures the behavior of rather complex systems. ... Scientific Seminar: Mathematical Modeling of Complex Systems . ...

Еще в разделе: (Показать все результаты (>20) - hcs.cmc.msu.ru/ )

. Summary of experimental results . The light absorbing capacity of phytoplankton, estimated from Fo , and its photosynthetic activity (estimated as Fv/Fm ) are key characteristics of the primary processes of photosynthesis. We suggested a formula for calculation of the primary production of phytoplankton from these two characteristics and underwater irradiance. The probing data were used to plot vertical profiles of phytoplankton productivity in various regions of the Baltic, Norwegian, and South China

Еще в разделе: (Показать все результаты (>11) - www.biophys.msu.ru/ )

International Symposium "Erosion and sediment yields in the changing environment" OCT. 11-15 2012 CHENGDU, CHINA International Symposium of IAHS-ICCE in 2012 CHENGDU, CHINA OCT. 11-152012 SYMPOSIUM THEME "Erosion and sediment yields in the changing environment" International Symposium "Erosion and sediment yields in the changing environment" OCT. 11-15 2012 CHENGDU, CHINA 1. ... Electronic files of International Symposium "Erosion and sediment yields in the changing environment" OCT. ...

Еще в разделе: (Показать все результаты (>38) - eng.geogr.msu.ru/ )

• Department of Land Hydrology
• Department of Oceanology
• ICCE events

MEIS : ­ 2007 ­ 3/802 537.9 538.975 P.N.Chernykh, G.A Iferov., ... S. Abo, S. Ichihara, T. Lohner, F. Wakaya, T. Eimori, Y. Inoue, M. Takai, Nuclear Instruments and Methods in Physics Research B237 (2005) 72. ... D.P.Woodruff, Nuclear Instr. and Methods in Phys. Research B256 (2007) 293. ... T.Gustafsson, H.C. Lu, B. W. Busch, W. H. Schulte, E. Garfunkel, Nuclear Instr. and Methods in Physics Research B183 (2001) 146. ... L.R. Doolittle, Nuclear Instr. and Methods in Physics Research B9 (1985) 344. ...

Еще в разделе: (Показать все результаты (>105) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/JPhys_ConfSer194_8_082007_VAKho.pdf
• http://danp.sinp.msu.ru/LIIWM/ArXiv-0904.2151v1_Khodyrev2009.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb206_830_GCIB_Applications_Equipment.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... MCCME, Moscow 3 papers and (a) English edition of the textbook "Probability", vol. ... Springer, Berlin, 2006. ... 4 C. Conferences (as a participant): · Plenary talk at the Conference on Probability Theory and Mathematical Statistics dedicated to the centenary of A. N. Kolmogorov (September 21­27, 2003, Tbilisi, Georgia); · Plenary talk at the Franco- Russian Colloquium Perspectives de coopґ ation en informatiques et mathґ er ematiques appliquґ ees (October 2003, Moscow ); · Plenary ...

Еще в разделе: (Показать все результаты (>59) - new.math.msu.su/ )

• http://new.math.msu.su/department/probab/spec/Materialy_po_kursam_Tutubalina/Finstat/Bashelie/Bachelier100years.pdf
• Olympiads
• Sessions

Software on Data Processing . We Offer Statistical Software And . Software On Data Analysis And Processing. ... The package is intended for those, who doesn't have large experience in statistical analysis, but needs a quick and convenient data processing tool. ... Package provides full complex of registration and analysis methods, individual EKG monitor-analyzer, special tools for complete polygraph analysis. price: 700$ - 2200$. phone number (095) 437-3695, 155-1365 . ... InCo . ...

Еще в разделе: (Показать все результаты (>5) - statsoft.msu.ru/ )

• InCo literature in English

Information message On November 2-3, 2005 Lomonosov Moscow State University will conduct jointly with the Academy of Cryptography of the Russian Federation the Forth All- Russian scientific Conference Mathematics and Security of Information Technologies and jointly with the Center of International Studies, Cambridge University , United Kingdom, Advanced Research Workshop Unconventional ... Conference Co-Chairmen 1. ... Sherstyuk V.P. - Security Council of the Russian Federation; 3. ...

Еще в разделе: (Показать все результаты (>13) - suny.msu.ru/ )

• http://www.suny.msu.ru/en/CyberCon05En.doc

International Laser Center of MSU . ... Education . ... Laser Graduate School . ... Home Education Continuing Education and Retraining Program . The International Laser Center of Moscow State University accepts visiting scholars from all over the world for training programs in laser physics and technologies. The ILC offers the following continuing education and retraining programs in these fields: . ... International Retraining and Post-docs Program; . Laser Graduate School short courses . ...

Еще в разделе: (Показать все результаты (>58) - ilc.phys.msu.ru/ )

• Laboratory of nonlinear polarization optics
• Альбомы

Cell Biology International 27 (2003) 293­294 Cell Biology International www.elsevier.com/locate/jnlabr/ycbir Short communication Microtubule dynamics in living cells : direct analysis in the internal cytoplasm Ivan A. Vorobjev a a,* , Irina B. Alieva a, Ilya S. Grigoriev b, Gary G. Borisy c Laboratory of Cell Motility, A.N. Belozersky Institute, Moscow State University, Moscow, Russia b Department of ... These data demonstrate that MT growth is impeded at the cell margin. ...

Еще в разделе: (Показать все результаты (>34) - cellmotility.genebee.msu.ru/ )

... Коснитесь одной паутинки, и дрогнут все остальные. ... Растениям и животным некому писать, за них некому заступиться, кроме нас, людей, которые вместе с ними населяют эту планету, но не являются ее собственниками." Джеральд Дарелл. Cбережем нашу землю | Oни должны жить | Hаши пернатые друзья . ... Что делать, если.. ...

Еще в разделе: (Показать все результаты (>32) - www.ecocoop.ru/ )

... Surface plasmon-polaritons (SPPs) is a collective oscillation of light and electrons that propagate at the boundary between metal and dielectric. ... Ultrafast Laser Pulse Shaping by Plasmonic Crystals . In our group, controllable reshaping of a femtosecond laser pulse reflected from a plasmonic crystal based on 1D polymer grating with period of 750 nm covered by 50љnm silver film. ... Pulse duration ? ... nonlinear crystal. ... Ultrafast Polarization Pulse Shaping with Plasmonic Crystals . ...

Еще в разделе: (Показать все результаты (>134) - nanolab.phys.msu.ru/ )

• Research | Laboratory of Nanophotonics & Metamaterials

BIOCATALYTICAL REAGENTLESS TECHNOLOGY FOR TREATMENT OF BIOGAS AND NATURAL GAS . ... Conventional technologies for treating such gases based on chemical reactions in a liquid phase, physical absorption and direct chemical conversion have several evident drawbacks - high reagent consumtion , equipment corrosion , application of high temperature and pressure etc. resulted in high process costs. ... Phone: 7-(095)-9395083 Fax: 7-(095)-9395417 or 9393589 . ...

Еще в разделе: (Показать все результаты (>156) - www.enzyme.chem.msu.ru/ )

• Lab of phys.-chim. basics of energy bioconversion
• B I O C A T A L Y S I S - 2007. Structure, functions, applications.
• Entrez-PubMed