. Область научных интересов . Сотрудники, приглашенные специалисты и студенты . Информация о научных конференциях и семинарах . Основные публикации . Наш адрес . Home page .

Еще в разделе: (Показать все результаты (>4) - www.srcc.msu.ru/ )

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>5) - tex.bog.msu.ru/ )

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>12) - lhe.sinp.msu.ru/ )

• Information for our Guests
• Irina A. Korzhavina's Home Page

arxiv:1307.8241 Кривая вращенияи распределение массы в центре Галактики --- от черной дыры до самых до окраин (Rotation Curve and Mass Distribution in the Galactic Center --- From Black Hole to Entire Galaxy) . Authors: Yoshiaki Sofue . ... Authors: D. Thornton et al. arxiv:1307.2944 Архив экзопланет NASA: Данные и инструменты для экзопланетных исследований (The NASA Exoplanet Archive: Data and Tools for Exoplanet Research) . ... обзор arxiv:1307.0041 Галактическая археология. ...

Еще в разделе: (Показать все результаты (>274) - astro.uni-altai.ru/ )

• Astronomy links

. Numerical methods of research on heat and mass intensification processes in power units. Book ?Numerical simulation of vertical intensification of heat transfer in tube packages? . Numerical simulation results of heat transfer intensification on ?eddy generating? surfaces with different turbulence models application. Heat and hydrodynamic pattern at flowing over the cylinder with ?eddy generating? elements

Еще в разделе: (Показать все результаты (>9) - termogaz.imec.msu.ru/ )

... Control of the Self Assembly Processes in a Droplet of a Colloidal Solution by an Acoustic Field O. V. Rudenkoa, P. V. Lebedev Stepanovb, V. A. Guseva, A. I. Korobova, B. A. Korshaka, N. I. Odinaa, M. Yu. ... The self assembly in the course of solvent evapora tion occurs owing to capillary forces, which displace the particles in the near surface layers of the solution as the volume of the latter decreases. ... For simplicity, we replace the actual droplet on a solid substrate by a plane liquid layer...

Еще в разделе: (Показать все результаты (>43) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/gordienko_files/localization_eng.pdf
• http://acoustics.phys.msu.su/teachers/rudenko_files/98sweisarv.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/trubochki.pdf

Russian Journal of Genetics, Vol. ... The inter-SINEґPCR method is based on the amplification of fragments situated between copies of SINEs, which are short retroposons spaced 100 to 1000 bp apart. ... In the case of primer MIL17, which initiates the amplification of loci flanked by tail-to-tailґoriented MIR copies, 100 to 200 fragments with a length of 100 to 1000 bp were detected in each bat DNA sample. ... Electrophoretic fractioning of MIRґPCR products of genomic DNA in 31 bat species. ...

Еще в разделе: (Показать все результаты (>58) - vertebrata.bio.msu.ru/ )

• http://vertebrata.bio.msu.ru/Shedlock_Okada_2000_BE.pdf
• http://vertebrata.bio.msu.ru/Individual_Project_Cranberry_2008.pdf
• Background of the Department

Optical imaging of fluorescent carbon biomarkers using artificial neural networks Tatiana A. Dolenko Sergey A. Burikov Alexey M. Vervald Igor I. Vlasov Sergey A. Dolenko Kirill A. Laptinskiy Jessica M. Rosenholm Olga A. Shenderova Downloaded From: http://biomedicaloptics.spiedigitallibrary.org/ on 12/17/ 2014 Terms of Use: http://spiedl.org/terms Journal of Biomedical Optics 19(11), 117007 (November 2014 ) Optical imaging of fluorescent ... Results of Using Artificial Neural Networks Fig. ...

Еще в разделе: (Показать все результаты (>27) - rswater.phys.msu.ru/ )

• http://rswater.phys.msu.ru/en/articles/2014/Carbon%20dots%20ND%20ppsc201300251.pdf
• Laboratory of laser spectroscopy of solutions of supramolecular compounds and

... Font: Times New Roman . ... size - А4 (21 cm х 29,7 cm) . ... Title should be typed in capital letters, Times New Roman, size 13, boldface font; formatting: center. ... The title and the number of the table should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... The title under the illustration should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... Use Times New Roman size...

Еще в разделе: (Показать все результаты (>24) - www.spa.msu.ru/ )

... Animal Welfare Information Center Bulletin [AWIC B] . Common information . ... no information] . ... since 1986-01-01 till today . ... free online journal, formerly known as [Animal Welfare Information Center Newsletter]; aka AWIC Bulletin . ... http://www.nal.usda.gov/awic/newslett.. ... today . ...

Еще в разделе: (Показать все результаты (>61) - journals.genebee.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt

SEMINAR Singular Perturbations and Time Scales (SPaTS) in Control Theory and Applications 14:30 PM, Saturday, June 23, 2012, Room 5-18 Faculty of Physics, M.V. Lomonosov Moscow State University , Moscow, Russia Professor D. Subbaram Naidu , PhD, PE, Fellow IEEE Director and Professor, School of Engineering Director, Measurement and Control Engineering Research Center Idaho State ...

Еще в разделе: (Показать все результаты (>7) - matematika.phys.msu.ru/ )

МГУ имени М.В.Ломоносова Русская версия . ... About Conference . Structure of the conference . ... Biology . Asian and African Studies . ... Global Studies and geopolitics . ... Art Criticism and History . History and Art History . ... Social studies and modernity . ... Cultural studies. ... International Conference for Students and Young Scientists "Lomonosov" . ... 29 Feb 2016 . ... ABSTRACT TEMPLATE FOR BIOLOGY SECTION OF LOMONOSOV CONFERENCE - 2016 . ... МГУ имени М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>14) - conf.msu.ru/ )

... Information for the applicants . ... News . ... The Faculty of Bioengineering and Bioinformatics, Lomonosov Moscow State University was founded in 2002 with the express purpose of training of highly qualified personnel for the universities, research institutes, medical companies and facilities, and pharmaceutical and biotechnology industries. ... Faculty of Bioengineering and Bioinformatics, office 433. ... 2016 Faculty of Bioengineering and Bioinformatics, . Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>10) - en.fbb.msu.ru/ )

• Background? Faculty of Bioengineering and Bioinformatics, MSU

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... Nanocrystalline materials based on metal oxides for the detection of toxic and hazardous gases in the air. ... sensorovEst material group hopes that the new materials developed at the Faculty of Chemical laboratory "Chemistry and physics of semiconductor and sensor materials " will substantially increase the artificial olfaction. ... Acetone Sensing by Modified SnO 2 Nanocrystalline Sensor Materials. ...

Еще в разделе: (Показать все результаты (>37) - www.lssm.inorg.chem.msu.ru/ )

• Лаборатория химии и физики полупроводниковых и сенсорных материалов | Воробьева
• Лаборатория химии и физики полупроводниковых и сенсорных материалов | Проекты
• The Laboratory of chemistry and physics of sensor and semiconductor materials

... 6, February, 2015 SESSIONS OF THE WORKSHOP OF THE MATHEMATICS AND MECHANICS DEPARTMENT OF LOMONOSOV MOSCOW STATE UNIVERSITY, "URGENT PROBLEMS OF GEOMETRY AND MECHANICS" NAMED AFTER V. V. TROFIMOV D. V. Georgievskii and M. V. Shamolin UDC 51(09) (For the b eginning of the list of sessions see J. Math. ... For these coefficients, we construct a recurrent system of ordinary differential equations. ... Some problems of microp olar elasticity theory. ... Stability of nonconservative mechanical systems. ...

Еще в разделе: (Показать все результаты (>36) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-167-1.pdf
• Mathematical Reviews

... Randles impedance. Interfacial capacitance. ... Partial currents ik in the bulk solution are determined by transport numbers tk . ... dl Thermodynamics of interfaces ґ binary solution : 2 independent variables, e.g. = +/z+ - -/zsolution: dE+ = ( Cdl )-1 d - t -dl d(/F) d+ = - t+dl d - Cdl d(/F) EDL: + , d- = - t -dl d + Cdl d(/F) metal : THREE independent interfacial parameters: (1) Cdl , interfacial capacitance ( capacitance of the electrical double layer ), (2) t+dl et t-dl , ...

Еще в разделе: (Показать все результаты (>85) - electr003.chem.msu.ru/ )

• Mikhail A. Vorotyntsev:CV
• Laboratory of Electrochemical energetics

... Alexey D. Neverov . ... Department of Bioengineering and Bioinformatics, Moscow State University. State Scientific Center GosNIIGenetika. ... EDAS human . EDAS mouse . EDAS dog (not availible now) . EDAS rat (not availible now) . To navigate this site please install the latest version of Macromedia Flash Player for Windows or for Linux . If you do not wish to install Flash you could use text pages with less functionality. ...

Еще в разделе: (Показать все результаты (>6) - edas2.bioinf.fbb.msu.ru/ )

• EDAS (human) - Alternative Splicing DataBase.
• EDAS (mouse) - Alternative Splicing DataBase.

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>19) - antares.sinp.msu.ru/ )