... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>8) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf
• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf

... Выпускники . Выпускники ВМиК . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Senior IFP Fall 2005 . The Center on Philanthropy and Civil Society's Senior International Fellows Program provides an opportunity for the professional development of Third-Sector practitioners from outside the United States who are decision makers in their professions. The program is designed to help build Third-Sector capacity in the Fellows' home countries. ...

Еще в разделе: (Показать все результаты (>489) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Конференция "Вакансии"
• Клуб выпускников МГУ: International Fellows Program
• Клуб выпускников МГУ: Nyg?rd использует стволовые клетки для достижения

General Information . ... The conference is organized by the Sternberg Astronomical Institute (SAI) of Moscow University and the IAU Working group "Site-testing Instruments" . ... Use of site data in telescope operation and adaptive optics. ... Recent conferences on this subject (2007, 2008) demonstrated great interest of the community, hence the need for a new meeting. ... Unlike previous recent conferences, this meeting will cover all aspects of site monitoring for optical/IR astronomy. ...

Еще в разделе: (Показать все результаты (>24) - site2010.sai.msu.ru/ )

• Timetable
• Results of ELT site testing programs - I
• Results of recent and ongoing site programs

... for Food Security . Home Events Online Consultation on Network and Partnerships.. ... This discussion will serve as a preparatory stage for the upcoming International Conference on International Conference on Eurasian Food Security and Nutrition Network and Eurasian Soil Partnership to be held in Bishkek, February 29-March 2, 2016. ... Topic 1: Building the Eurasian Food Security Network . ... International Forum on Eurasian Food Security and Nutrition Network and Eurasian Soil Partnership read . ...

Еще в разделе: (Показать все результаты (>62) - ecfs.msu.ru/ )

• The structure of the ECFS | ECFS
• The Expert Council of ECFS | ECFS
• About Eurasian Center for Food Security | ECFS

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... Data and place of birth: . ... Excitation of nuclear and hadron degree of freedom in hadron-nucleus interaction . ... Participation in experiments: . The theoretical calculation and the analysis of data in experiment of ITEP (Moscow,1972-1978) on the Rho-meson production by pions at 3.72 Gev/c on nuclear target . ... The analysis of data in SMS MSU experiment (Dubna, 1985-1990) devoted to the space-time structure of hadron interaction in proton- nucleus collisions at 9 GeV/c (JINR accelerator) . ...

Еще в разделе: (Показать все результаты (>58) - lav01.sinp.msu.ru/ )

• ASI "Structure and Dynamics of Elementary Matter", September 21 - October 2,
• Involving Hadronic Interactions Laboratory in Experiments

... Scientific Effort . ... Cosmic ray astrophysics . Space Physics . ... Nuclear physics . ... The paper was prepared with contributions from Elena Popova from the Skobeltsyn Institute of Nuclear Physics (Lomonosov Moscow State University) and was published in Scientific Reports. ... Federal State Budget Educational Institution of Higher Education M.V.Lomonosov Moscow State University, Skobeltsyn Institute of Nuclear Physics (SINP MSU), 1(2), Leninskie gory, GSP-1, Moscow 119991, Russian Federation . ...

Еще в разделе: (Показать все результаты (>5) - sinp.msu.ru/ )

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>170) - www.pereplet.ru/ )

• program

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>3) - composite.msu.ru/ )

• Department of the Composites Mechanics

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>14) - tukachev.flogiston.ru/ )

• Category: Новости

... Manuscripts submitted to the journal should be divided into the following sections: Title page, Abstract (in Russian and English), Key words (in Russian and English), main manuscript text, list of references, tables, figures and figure captions. ... Full size of the article includes list of references, tables and figures. ... Rich text format (*.rtf) . ... References are given in the text in square brackets; full references are given at the end of the manuscript in the section List of references. ...

Еще в разделе: (Показать все результаты (>27) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/vestnic/e2014_4.doc
• http://www.antropos.msu.ru/vestnic/e2014_1.doc
• http://www.antropos.msu.ru/vestnic/e2013_2.doc

... Separation of all runs on several groups by mean active sectors. ... Ways to carry out step 2: trying to cut off all points which don't reach the fit line with errors. Ways to carry out step 2: mean active sectors selection Ways to carry out step 2: results of mean active sectors selection by example of set 2 Failing of mean active sector selection method on example of set 3: one point is still on the graph Introduction of new distance parameter How to find an optimal distance parameter? ...

Еще в разделе: (Показать все результаты (>21) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/seminar/Yakovenko.pdf

... Kornev, V., Sharafiev, A., Kolotinskiy, N., and Mukhanov, O. Microwave dynamics of superconducting quantum cell.љ ... DOI љ] . ... Kornev, V., Sharafiev, A., Soloviev, I., and Mukhanov, O. Signal and noise characteristics of bi-squid.љ ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., Skripka, V., and Mukhanov, O. Superconducting quantum arrays.љ ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., and Mukhanov, O. Superconducting quantum arrays for broadband rf systems.љ ...

Еще в разделе: (Показать все результаты (>28) - cryolab.phys.msu.ru/ )

• Victor K. Kornev
• Nikolay V. Kolotinskiy
• Artem S. Trifonov

... The Department of Operations Research . ... Welcome Traditional topics of the conference Important dates Abstracts Registration . Final program Accommodation Program committee Organizing committee . Coordinators Contacts . V Moscow International Conference . on Operations Research, . ... Moscow, April 10-14, 2007 Contacts . ... E-mail address for abstracts: io@cs.msu.su . Co-chair of Organizing Committee: . ... e-mail: vasin@cs.msu.su . phone: +7 495 939 24 91 . ...

Еще в разделе: (Показать все результаты (>12) - io.cs.msu.ru/ )

• Program committee - ORM 2007
• Final program - ORM 2007

... This book contains scientific papers prepared by researchers of Moscow State University and Autonomous University of Puebla in accordance with a special Russian--Mexican scientific program. ... Institute of Mathematical Studies of Complex Systems, Moscow State University . ... Institute of Nuclear Physics, Moscow State University . ... The book is edited by Rector of Moscow State University Dr. V.A. Sadovnichii and Rector of Autonomous University of Puebla Dr. E. Doger Guerero. ...

Еще в разделе: (Показать все результаты (>161) - num-anal.srcc.msu.ru/ )

... The Council on Complex Problems of Cosmic Rays of the Russian Academy of Sciences and the Skobeltsyn Institute of Nuclear Physics (SINP) of Lomonosov Moscow State University are planning to held a workshop "Cosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century" on May 16-18 2011 at the Moscow State University. ... The Workshop banquet will be held on Tuesday, May 17 th . ... Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century"...

Еще в разделе: (Показать все результаты (>6) - tunka.sinp.msu.ru/ )

... ESA Space Weather Activities | ... Space Environments and Effects Analysis Section, | ... Introduction THE NATURAL SPACE ENVIRONMENT REPRESENTS A CONSIDERABLE HAZARD FOR SPACECRAFT AND THE EUROPEAN SPACE AGENCY (ESA) HAS FOR MANY YEARS TAKEN MEASURES TO ENSURE THAT ITS SPACECRAFT ARE ABLE TO SURVIVE AND OPERATE IN IT. ... 2.2 Radiation Effects As in other space agencies, ESA's concerns with space weather effects probably began with concerns over radiation effects on spacecraft systems. ... 2000). ...

Еще в разделе: (Показать все результаты (>105) - www.kosmofizika.ru/ )

• http://www.kosmofizika.ru/pdf1/KISHCHA_JASTP99.pdf
• Я. И. Фельдштейн, Ю. И. Гальперин , ч.6 Список литературы
• L.Lazutin, List of publications

... Alexander Konstantinov, music director . ... Olga Nazajkinskaja (soprano) . ... Aleksandr Konstantinov (violin) . Tatiana Andrianova (harpsichord) . ... Johann Sebastian BACH (1685 - 1750) . ... Suschevskaja str, 14 ('Novoslobodskaja' metro station) . ... 3 0 p.m. Central Restoration Workshops of Moscow Architectural Institute . ... 1685 - 1750) . ... 0 0 p.m. M.V. Lomonosov Moscow State University . ... Moscow State University, the Main building at Vorob'evy Gory (' University ' metro station) . ...

Еще в разделе: (Показать все результаты (>23) - music.genebee.msu.ru/ )

... This applet generates an observing list based on an observer's location and time. ... To use this program, enter in your location, and the local times at which you wish to begin and end observing. The date you enter should correspond to the calendar day at the time at which you begin observing. For example, if you wish to observe from 9:37 PM October 23, 2007 until 3:21 AM October 24, 2007, you would enter 21:37 for the starting time, 03:21 for the finish time, and 10/23/2007 for the date. ...

Еще в разделе: (Показать все результаты (>19) - observ.pereplet.ru/ )

Contemporary interpretation of morphology as a way of obtaining new data on the ecology and evolution of vertebrates (exemplified by birds) Felix Ya. ... 1950, 1957, 19706, 1974, 1983), - . ... 1997) ".. ... 1974; , , 1977; , 1982, 1991; Korzun et al., ... 1957, 19706, 1983), . ... 1958, 1965; Bock, 1964; , 1972, 1982, 1997; , 1978; Zusi, 1984 ), , , - . Zusi, 1974) . ... 1961, 1965). ... 1974). ... 1965, . ... 19706,1974,1983). ... 1965, 1970; , 1972). ... 1982, . ... 1964, Vol. ... 1972, Vol. ...

Еще в разделе: (Показать все результаты (>70) - vertebrata.bio.msu.ru/ )

• http://vertebrata.bio.msu.ru/Doklady_Binlngical_Sciences.pdf
• Student Reports at International Conferences
• Выступления студентов и аспирантов на конференциях