... Nonlinear optics of ionized mediums . Fiber lasers . ... Emergence of powerful laser systems, being able to deliver powerful ultrashort light pulses, allows one to investigate and exploit new class of nonlinear-optical phenomena, based on the media ionization, when the electrons are released by strong electromagnetic field directly or by collision of an atom with another electron accelerated in the field. ... Ultrafast optical switching of an ionized medium by interfering ultrashort laser pulses. ...

Еще в разделе: (Показать все результаты (>3) - photonicslab.phys.msu.ru/ )

... proposals* are presented by multinational consortia of organisations/individuals Proposals are evaluated by independent experts All proposal coordinators receive an Evaluation Summary Report Funding follows successful evaluation, selection and negotiation of grant agreement * except certain Support actions ··· 2 Who can participate · Three independent legal entities from three different EU Member States or Associated countries (presently ... 19 Proposals and projects in FP7 3. ...

Еще в разделе: (Показать все результаты (>82) - www.msu.ru/ )

• http://www.msu.ru/projects/amv/doc/h6_1_6_1_nom8_2.pdf
• http://www.msu.ru/science/details/2010/101021-moscow-eu-ru-call.pdf
• http://www.msu.ru/news/official/2009/memorandum_eng.doc

EUROPEAN COMMISSION Education and Culture Lifelong Learning: Education and Training policies Vocational training and adult education FUNDAMENTALS OF A `COMMON QUALITY ASSURANCE FRAMEWORK' (CQAF) FOR VET IN EUROPE (updated version of 29/09/05) Contact person: Fernanda Oliveira Reis, DG Education and Culture ( fernanda.oliveira-reis@cec.eu.int ) 1 TABLE OF CONTENTS 1. ... The second rationale was to link quality management activities to policy objectives agreed at European level for the VET systems. ...

Еще в разделе: (Показать все результаты (>42) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/documents/umo/bologne/TOWARDS%20THE%20EUROPEAN%20HIGHER%20EDUCATION%20AREA%20Communiq%20of%20the.pdf
• Вестник МГУ

Program XXXVI International Conference of the Russian Society for American Culture Studies Nature and Sustainability of Culture Moscow, December 3-10, 2010 Section 1. ... Nature in the nineteen-century American culture (The concept of Nature and its evolution from Romanticism to Naturalism. ... O.Y. Danchevskaya Moscow State Pedagogical University, Moscow, Russia Concept of Soul among North American Indians Soul is probably the most vital notion in any religion, though ideas about it vary greatly. ...

Еще в разделе: (Показать все результаты (>46) - www.journ.msu.ru/ )

• The Second International Media Readings in Moscow :: Факультет журналистики МГУ
• The students of the Faculty of Journalism visited the Saxion University ::
• The Second International Media Readings in Moscow

... Nonlinearoptical magnetic Kerr effect in MPC with a half-wavelength-thick Bi-substituted yttrium­iron­garnet layer sandwiched between two dielectric Bragg reflectors is studied in transversal, longitudinal, and polar configurations of the dc magnetic field application when the fundamental radiation is in the resonance with the allowed microcavity mode located in the photonic band gap. ... The SH intensity is enhanced as the fundamental wave is in resonance with the microcavity mode. ... Phys. Lett. ...

Еще в разделе: (Показать все результаты (>39) - shg.phys.msu.ru/ )

• http://shg.phys.msu.ru/ruscon/articles/pdf/04_JAP95_7330.pdf
• http://shg.phys.msu.ru/ruscon/articles/pdf/04_LasPhys_14_porous.pdf
• http://shg.phys.msu.ru/ruscon/articles/pdf/02_apb74_653.pdf

... The notion of convergence to zero in a vector space allows one to define convergence to any p oint by using a translation. ... The notion of a converging sequence can b e introduced without any top ology, by the definition of all sequences converging to some p oint. ... 1, then the sequence n xn converges to zero. ... In the case of the Euclidean top ology, where for at least one comp onent the inequality ci > 1/4 holds, the set J (f ) coincides with the whole space and hence the Julia set is empty....

Еще в разделе: (Показать все результаты (>35) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-165-1.pdf
• http://shamolin2.imec.msu.ru/art-160-1.pdf
• http://shamolin2.imec.msu.ru/art-133-1.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... The eigenvalues of the effective slip-length tensor, however, in general case become dependent on the gap and cannot be viewed as a local property of the surface, being a global characteristic of the channel. ... 35) ) cos(n z), (27) This expression for an effective slip length depends strongly on a texture period L. When b L we again derive the areaaveraged slip length beff | ... Color online) Eigenvalues of the effective slip-length tensors simulated in the limit of a thin channel (symbols). ...

Еще в разделе: (Показать все результаты (>34) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/JCP2013.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp20042.pdf
• http://nanofluidics.phys.msu.ru/paper/Dubov_2012.pdf

... 2 · ­ , , · ­ · ­ , 03.12.2015 . ... 14 03.12.2015 · · · 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>7) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_advanced_networks/ITU_OTN_Tutorial.pdf
• http://lvk.cs.msu.su/~sveta/4-2wireshark.pdf

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>25) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>92) - npidb.belozersky.msu.ru/ )

• NPIDB: Home

Federation of European Societies on Trace Elements and Minerals PRELIMINARY SCIENTIFIC PROGRAM 09.06.2010 SESSION 1. Trace element and mineral analysis of environmental and biological samples: bulk determination, speciation and quality control. ... 10.06.2010 SESSION 2. ... SYMPOSIUM ORGANIZATION Venue The 4th International Symposium on Trace Elements and Minerals in Medicine and * Biology will take place in the Hotel "Okhtinskaya" (4, Bolsheokhtinsky prospect, 195027 St.Petersburg, Russia). ...

Еще в разделе: (Показать все результаты (>6) - www.fbm.msu.ru/ )

• http://www.fbm.msu.ru/about/struct/labs/lima/paper1.pdf

. Summary of experimental results . The light absorbing capacity of phytoplankton, estimated from Fo , and its photosynthetic activity (estimated as Fv/Fm ) are key characteristics of the primary processes of photosynthesis. We suggested a formula for calculation of the primary production of phytoplankton from these two characteristics and underwater irradiance. The probing data were used to plot vertical profiles of phytoplankton productivity in various regions of the Baltic, Norwegian, and South China

Еще в разделе: (Показать все результаты (>9) - www.biophys.msu.ru/ )

• THE PRINCIPLES OF THE DOUBLE-FLASH FLUOROMETRY

... Inorganic Materials Sciences . ... Development of well defined inorganic materials for chemical and physical sensors on the base of complexe oxides, vanadates and phosphates. ... The laboratory staff carries out fundamental research on gas sensors on the base of SnO2; chemistry and technology of scandium; chemistry of complex oxides of zirconium, hafnium and rare-earth elements; chemistry of complex phosphates, vanadates, arsenates and tellurates of rare earths, gallium and scandium. ...

Еще в разделе: (Показать все результаты (>58) - www.inorg.chem.msu.ru/ )

• Ardashnikova E.I.
• Diploma
• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds

... 1998 1 : Defended the Doctorate Degree Thesis on "Models of Cosmic Ray Particle Fluxes (Development and Applications)". ... Space Weather . ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv. ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv.Space Res. ...

Еще в разделе: (Показать все результаты (>7) - srd.sinp.msu.ru/ )

European Research Council IDEAS Coordination and Support Action (CSA) Call identifier: ERC -2009-SUPPORT Guide for Applicants Version: 16 July 2008 The Guide is published by the ERC -DIS on http:// erc .europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu European Commission FP7 Specific Programme IDEAS ... Consequently, the ERC needs to be rigorous in evaluating the very best science and researchers and in selecting innovative and "high risk/high gain" projects. ...

Еще в разделе: (Показать все результаты (>35) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/call_StG_2012.pdf
• http://ideas.msu.ru/docs/ERC_guide_preparation.pdf
• http://ideas.msu.ru/docs/call_SyG_2012.pdf

... The "Mulliken" AMMs up to the fourth order were calculated within the scheme developed by Saunders et al. [13] using the B3LYP, Perdew-Wang (PW91), and Perdew-BurkeErnzerhof (PBE) functionals with the 6-21G** basis set (for shortness, noted below basis set 3 or BS3) for all ALPOs, while the ATN and ATO structures were also considered at other levels as STO-3G (BS1), 3-21G (BS2), and 8-511G*(Al)/8-521G*(P)/8411G*(O) (BS4) for comparison. ... No EP convergence with the basis set was observed. ...

Еще в разделе: (Показать все результаты (>24) - beams.chem.msu.ru/ )

• http://beams.chem.msu.ru/doc/Dynamical_systems_Theory_and_applications.pdf
• http://beams.chem.msu.ru/doc/JCPSA613314144101_1.pdf
• Публикации

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

... H. Purcell: The Fairy Queen - Act IV . Г. Перселл: Королева фей - Акт IV . Act III . Акт III . ... Act V >> . Акт V >> . ... After Titania and Bottom have asleep the adaptation follows Shakespeare's third act with the confusion involving the two couples Hermia and Lysander, Helen and Demetrius, up to the point where they all fall asleep too. ... Phoebus appears on a cloud and greets the new day: the four Seasons enter and conclude the magnificent spectacle with songs and dances. ...

Еще в разделе: (Показать все результаты (>14) - music.genebee.msu.ru/ )

Automorphisms and isomorphisms of Chevalley groups of typ e G2 over lo cal rings with 1/2 and 1/3 E. I. Bunina M.V. Lomonosov Moscow State University Russia, 119992, Moscow, Leninskie Gory, Main Building of MSU, Faculty of Mechanics and Mathematics, Department of Higher Algebra email address: helenbunina@yandex.ru Abstract. ... We describe automorphisms of Chevalley groups of type G2 over local rings with 1/2 and 1/3. ... References [1] Abe E. Automorphisms of Chevalley groups over commutative rings. ...

Еще в разделе: (Показать все результаты (>12) - halgebra.math.msu.su/ )

• http://halgebra.math.msu.su/staff/klyachko/papers/cyclic.pdf
• http://halgebra.math.msu.su/wiki/lib/exe/fetch.php/staff:yjabr12829.pdf
• http://halgebra.math.msu.su/wiki/lib/exe/fetch.php/staff:bunina:bunina_proofs.pdf