Встреча через 40 лет... Встреча 2003 года . Листая старые альбомы... Back to Department of Physics , Союз Выпускников физического факультета МГУ .

Еще в разделе: (Показать все результаты (>5) - upmsu.phys.msu.ru/ )

. Загружено: Vovez . Дата загрузки: 06.03.2010 . Размер: 154.3 Кбайт . Подпись: 109 . Описание: ...

Еще в разделе: (Показать все результаты (>5) - www.dubinushka.ru/ )

• Фотоархив | Все... совсем все

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>49) - sn.sai.msu.ru/ )

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>13) - www.sciencepark.ru/ )

• MSU Science Park

Boris B. Damaskin . ... With this volume we celebrate the 70th birthday of Professor Boris Borisovich Damaskin and honor his long and distinguished career in electrochemistry. ... He started with the development of an adsorption theory for organic molecules, which is now presented in textbooks as the Frumkin - Damaskin theory. ... Professor Damaskin is a member of the International Society of Electrochemistry and Vice Editor-in-Chief of the Russian Journal of Electrochemistry. ... Oleg A. Petrii . ...

Еще в разделе: (Показать все результаты (>57) - electr003.chem.msu.ru/ )

• In memory of Sasha Kuznetsov

University Satellites and . Space Science Education . ... Abstract Submission List of submitted abstracts . Registration List of registred participants . ... When you do a reverse osmosis water treatment comparison to multi-stage selective filtration reverse osmosis always loses. ... The list of abstracts submited . Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>197) - cosmos.msu.ru/ )

. Тамбов - фотографии Аленки . P1010004.jpg . P1010005.jpg . P1010006.jpg . P1010007.jpg . P1010009.jpg

Еще в разделе: (Показать все результаты (>4) - sergeys.guru.ru/ )

• Тамбов
• Тамбов, фотографии Ромы Арутюняна
• Тамбов, фотографии Саши Суркова

Главное здание МГУ . ... Мы рады приветствовать Вас на сайте msu.mnc.ru, представляющем коллекцию фото одного из самых красивых и величественных зданий Москвы - главного здания МГУ на Ленинских Горах в Москве. Основная часть нашего сайта - МГУ в фотографиях. Здесь Вы сможете увидеть множество фотографий главного здания МГУ, снятых в разное время, с разных сторон и при различном освещении. ... фото главного здания МГУ с различных сторон . ... фотографии парка, окружающего главное здание МГУ . ...

Еще в разделе: (Показать все результаты (>2) - msu.mnc.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>36) - storage.bioinf.fbb.msu.ru/ )

QUANTUM STOCHASTIC PROCESSES This course is for 4-5th year and graduate students. ... It is dedicated to systematic account of Quantum Stochastic Processes right in the form they are actually used in theoretical calculations of Quantum Open Systems. ... LECTURE 2. ... Open systems and quantum stochastic processes. Mathematical definition of an open system and quantum stochastic process. ... Markovian quantum stochastic processes. Formal definition of quantum markovian stochastic process. ...

Еще в разделе: (Показать все результаты (>82) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/JRS-2002-en.pdf
• http://qilab.phys.msu.ru/papers/Laser-Physics-20(1)107-118(2010).pdf
• http://qilab.phys.msu.ru/papers/SPIE-672722-11(2007).pdf

... 2000. ... С. 3995-4010. ... Комплексная кратковременная модель пром. источников использовалась для оценки выбросов диоксинов и фуранов в районе установки по сжиганию твердых муниципальных отходов в Коламбусе (США) в 1994-1996 г.г. Исходные данные были получены при мониторинге состояния воздуха и почвы и использовании метеоданных, параметров системы выбросов и характеристики пород. ... воздушная среда, диоксины, почва, прогнозирование, фураны . ...

Еще в разделе: (Показать все результаты (>14) - ecoinformatica.srcc.msu.ru/ )

... For full UV energy Euv (erg) radiated in TLE the corresponding number of photons of wavelength =300-400 nm (with average energy 3.5 eV) is: Nph=Euv/3.5в1.6 10-12 (1) We considered 2 options of the pinhole camera focal distance: 1. focal distance is short so that the circle of diameter 40 km is observed by one pixel and 2. focal distance is long so that the 40 km circle is observed in many camera pixels. ... Full energy released in UV in the atmosphere is determined by the pixel signal. ...

Еще в разделе: (Показать все результаты (>3) - cosrad.sinp.msu.ru/ )

• http://cosrad.sinp.msu.ru/experiments/tus/doc/HO2COSPAR2006.pdf

... Registration . ... Abstract submission . ... Online abstract submission is still open! Click here to download the abstract form. ... Once your abstract has been submitted you will receive an email confirmation. ... All accepted abstracts will be published as is in the CD-ROM version of the Conference proceedings, and uploaded on the Conference website. ... The guarantee of publication of your abstracts is your personal participation in the conference. ... Registration closed! ...

Еще в разделе: (Показать все результаты (>28) - www.elch.chem.msu.ru/ )

... Горебогатырь Косометович (Poorhero Miss-the-target) 2001 (1) >> . ... Юбилейное представление "Нам 25, но мы опять.. Jubilee) 2005 (1) >> . ... Галантная Европа (L'Europe galante) 2008 (1) >> . ... OLD ALBUM (before 2001) >> . 2008 The Early Music Theatre Text graphics . 2008 Sergei Shishkin Design . ...

Еще в разделе: (Показать все результаты (>58) - www.tsm-msu.ru/ )

• The Early Music Theatre -- Photo 1
• The Early Music Theatre -- Photo 2
• The Early Music Theatre -- Photo 3

Image inpainting Outline · Why inpaint? Image filtering ( convolution ), simplest inpainting · Heat flow, diffusion process, diffusion equation · Anisotropic diffusion · Further development Partly taken from Restoring profanity by Carola SchЖnlieb Inpainting applications · · · · Image restoration Object removal Text removal Special effects Image courtesy Andrea Baczynski Simplest inpainting · ... Apply Matlab's median filter function medfilt2 on the Mandrill and Lena images. ...

Еще в разделе: (Показать все результаты (>10) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf
• Imaging lab: people

Alexander P. Seyranian . Institute of Mechanics , . Moscow State Lomonosov University , . ... Phone: (7495) 939 2039 . Fax: (7495) 939 0165, 939 2065 . ... My field of specialization are Stability Theory, Parametric Resonance, Gyroscopic Stabilization, Mechanics of Solids, Structural Optimization, Singularities and Bifurcations. ... Technical University of Denmark . Aalborg University, Denmark . ... Institute of Engineering Mechanics and Systems, University of Tsukuba, Japan . ...

Еще в разделе: (Показать все результаты (>3) - seyranian.imec.msu.ru/ )

• Selected Photos

... Becoming Your Own Boss Many people start a small business in order to enjoy the perceived rewards of freedom and independence. This is understandable because owning your own business can offer you the opportunity to experience freedom: . ... the freedom to earn as much as you want. ... It is fine for you to dream about becoming your own boss some day, however, before you put too much work into your business, make sure that the area you choose is the right one for you. ...

Еще в разделе: (Показать все результаты (>14) - innovation.msu.ru/ )

... Font: Times New Roman . ... size - А4 (21 cm х 29,7 cm) . ... Title should be typed in capital letters, Times New Roman, size 13, boldface font; formatting: center. ... The title and the number of the table should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... The title under the illustration should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... Use Times New Roman size...

Еще в разделе: (Показать все результаты (>22) - www.spa.msu.ru/ )

• Visa Support Information

... Форумы > Разное > Тема . Автор темы познающий тех . ... познающий тех . проблемы с техом . ... d:/progra~1/emtex/mfinput/cm/cmbx7.mf (d:/progra~1/emtex/mfinput/cm/cmbase.mf) . d:/progra~1/emtex/mfinput/roman.mf (d:/progra~1/emtex/mfinput/rus/coding.mf) . d:/progra~1/emtex/mfinput/rus/cyrl.mf [191] [171] [169] [184] [180] [176] . ... 188] [190]) (d:/progra~1/emtex/mfinput/rus/cyru.mf [139] [135] [159] [157] . ... 154] [155] [156] [158]) (d:/progra~1/emtex/mfinput/rus/cyrpunct.mf [192] . ...

Еще в разделе: (Показать все результаты (>135) - www.mmonline.ru/ )

• MMOnline | Форумы | Разное | Критика российской внешней политики
• MMOnline | Новости | Математический семинар Глобус, заседание 12 октября 2006...
• Математический семинар Глобус, заседание 12 октября 2006 г.

Communicating Through Art, L.Vershbow . ... But here I am, and as a designer, I will attempt to explain to you how I perceive art and design as a form of communication. Most of us think of art as the works that hang in museums and on the walls of our homes. ... But art, design and symbols, whether they are aesthetically pleasing or not, are all around us, and they help to guide us through the complexities of everyday society. ... Today I am a designer and creator of contemporary jewelry. ...

Еще в разделе: (Показать все результаты (>18) - suny.msu.ru/ )