Research paper Struct Multidisc Optim 27, 435 ­ 445 (2004) DOI 10.1007/s00158-004-0388-x Optimal shapes of parametrically excited beams A.A. Mailybaev, H. Yabuno, and H. Kaneko Abstract Straight elastically supported beams of variable width under the action of a periodic axial force are considered. Two shape optimization problems for reducing parametric resonance zones are studied. In the first problem, the minimal (critical) amplitude of the excitation force is maximized. ...

Еще в разделе: (Показать все результаты (>29) - mailybaev.imec.msu.ru/ )

• http://mailybaev.imec.msu.ru/papers/Mailybaev2003.pdf
• http://mailybaev.imec.msu.ru/reviews/Olhoff.pdf

... ESA Space Weather Activities | ... Space Environments and Effects Analysis Section, | ... Introduction THE NATURAL SPACE ENVIRONMENT REPRESENTS A CONSIDERABLE HAZARD FOR SPACECRAFT AND THE EUROPEAN SPACE AGENCY (ESA) HAS FOR MANY YEARS TAKEN MEASURES TO ENSURE THAT ITS SPACECRAFT ARE ABLE TO SURVIVE AND OPERATE IN IT. ... 2.2 Radiation Effects As in other space agencies, ESA's concerns with space weather effects probably began with concerns over radiation effects on spacecraft systems. ... 2000). ...

Еще в разделе: (Показать все результаты (>202) - www.kosmofizika.ru/ )

• http://www.kosmofizika.ru/pdf2/scl_open_e.doc
• http://www.kosmofizika.ru/pdf2/e_p_apatity08.pdf

... A new mechanism governing the dynamics of territory changing between groups of people such as countries is proposed based on trading with approval of both sides under particular voting rule (veto rule, majority rule, etc.) ... A state equation is obtained based on particular personal utility function. ... The countries which have approximately the same marginal 4 utility of the territory at the border would fight rather than trade as a result of equilibrium in the corresponding game. ...

Еще в разделе: (Показать все результаты (>9) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/ENOC2014.pdf
• Anton O. Belyakov

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

Laboratory of Microfluidics and Nanofluidics . Laboratory of Physical Chemistry of Modified Surfaces . ... Research . ... Laboratory of Micro- and Nanofluidics . ... Professor B.V.Derjaguin moved to the Laboratory with his research group as an Emeritus Professor. ... In 1993 Professor Olga I. Vinogradova took over the leadership of the Laboratory. In 2009 the Laboratory of Micro- and Nanofluidics was organized by Professor Olga I. Vinogradova at the Physics Department of the M.V.Lomonosov MSU. ...

Еще в разделе: (Показать все результаты (>33) - nanofluidics.phys.msu.ru/ )

Space Weather . ... Models . Data . ... Space Weather Analysis Centre of SINP MSU provides information about the current state of near-Earth's space. Information Services ( SWX ) on the website of the center provide access to current data describing the level of solar activity, geomagnetic and radiation state of the magnetosphere and the heliosphere in the real time. For data analysis, the models of the space environment, working in off-line as well as on-line mode have been implemented. ...

Еще в разделе: (Показать все результаты (>1225) - swx.sinp.msu.ru/ )

... A p P EC Astropar ticle Physics for Europe · Cosmic rays: A large array for the detection of charged cosmic rays ( Auger North) · Gamma rays: A large array of Cherenkov Telescopes for detection of cosmic high energy gamma-rays ( CTA ) · High energy neutrinos: A cubic kilometre-scale neutrino telescope in the Mediterranean (KM3NeT) · Dark matter search: Ton-scale detectors ... A p P EC Astropar ticle Physics for Europe · Cosmic rays: ­ ­ ­ ­ ­ AMS detector launched. ...

Еще в разделе: (Показать все результаты (>4) - tunka.sinp.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>14) - tukachev.flogiston.ru/ )

• Category: Новости

... 10, 63 ­ 64 (2010) / DOI 10.1002/pamm.201010024 Integrability and nonintegrability in terms of transcendental functions in dynamics of a rigid body Maxim V. Shamolin1, 1 Institute of Mechanics, Lomonosov Moscow State University, Michurinskii Ave., ... This circumstance allowed the author to perform a complete analysis of all phase trajectories and highlight those properties of them which exhibit the roughness and preserve for systems of a more general form. c 2010 Wiley-VCH Verlag GmbH & Co. ...

Еще в разделе: (Показать все результаты (>27) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-185-2.pdf

LabVIEW. ... National Instument DAQ, LabVIEW LPT COM , GPIB . ... RS-232 GPIB . RS-232 / GPIB, LabVIEW. ... RS-232 IEEE-488 (GPIB). ... RS-232 , DTE (Data Terminal Equipment) -- ( ), -- DCE (Data Communications Equipment) -- ( ). DTE () -- , DCE () -- , RS-232 (, , ), . ... LabVIEW, National Instruments http://ni.com/support/gpib/versions.htm. ... VISA Read COM Receive GPIB ), , . VISA Write Send COM GPIB . ... VISA Read Receive , «read buffer» ( «data string» GPIB) Create\Indicator. ...

Еще в разделе: (Показать все результаты (>3) - www.test.physchem.msu.ru/ )

• http://www.test.physchem.msu.ru/doc/publist.pdf

... These CDD-NDs are produced by specific acid treatment of detonation soot, forming tiny rounded sp2 carbon species (carbon dots), 1­2 atomic layers thick and 1­2 nm in size, covalently attached to the surface of the detonation diamond nanoparticles. ... In this paper, we report that specific acid treatment of NDcontaining detonation soot, produces tiny rounded sp2 carbon species (carbon dots), which are 1­2 atomic layers thick and covalently attached to the surface of DND particles. ... Figure 4. ...

Еще в разделе: (Показать все результаты (>20) - rswater.phys.msu.ru/ )

• http://rswater.phys.msu.ru/en/articles/2015/PSS.pdf
• Laboratory of laser spectroscopy of solutions of supramolecular compounds and

C ALL FOR CONTRIBUTIONS EABIS 11th ANNUAL COLLOQUIUM HOSTED BY IMD LAUSANNE, JULY 3-4, 2012 "STRATEGIC INNOVATION FOR SUSTAINABILITY" A BOUT THE COLLOQUIUM The EABIS Annual Colloquium is an international forum that brings together 250-300 senior figures from industry, academia, policy-making and civil society. ... IMD's long-standing Corporate Sustainability Management (CSM) Platform is a corporate membership and multi-faculty driven research & learning initiative that is now linked to the new Center. ...

Еще в разделе: (Показать все результаты (>28) - www.mgubs.ru/ )

• http://www.mgubs.ru/images/Image/courses%20overview%20BA6%20eng.doc

... We will dwell on linguistic aspects and Lexical Resources of POLITEXT branch having in mind some intermediate semantic representation of a whole text as the basis for differentiated Information Extraction. It is personal data (in the social sphere) recognition in texts that we focus on, see (Leontyeva et al. ... As the main instrument of semantic analysis of coherent texts this dictionary bears the important information on how to build BTF-units starting from lexemes of SemDict entries. ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

... О кафедре . ... Завершился курс "Методы лабораторных зоологических исследований", впервые проводимый в этом году. ... 11-й Морской семинар! Продолжить чтение . 31 марта 2016 (четверг), 13:00, 594 ауд. - заседание кафедры . ... Десятый семинар центра морских исследований МГУ . ... Девятый семинар центра морских исследований МГУ . ... JavaScript must be enabled in order for you to use Google Maps. However, it seems JavaScript is either disabled or not supported by your browser. ...

Еще в разделе: (Показать все результаты (>3) - invert.bio.msu.ru/ )

• История кафедры
• Учебный процесс

ISTITUTO NAZIONALE DI FISICA NUCLEARE Sezione di Genova INFN/TC-06/14 October 17, 2006 A FIBER OPTIC AIR BACKED MANDREL HYDROPHONE TO DETECT HIGH ENERGY HADRONIC SHOWERS IN THE WATER M.Anghinolfi1, A.Calvi3, A.Cotrufo3, M.Ivaldi1, O.Yershova2, F.Parodi1, D.Piombo1, A.Plotnikov2 and L.Repetto3 1) INFN-Sezione di ... UniversitЮ degli Studi di Genova, Dipartimento di Fisica Via Dodecaneso 33, I-16146 Genova, Italy Abstract We have studied the design of an air-backed ...

Еще в разделе: (Показать все результаты (>16) - antares.sinp.msu.ru/ )

• ANTARES в МГУ

... Electronic journal Issue 4. 10 september 2004 Leigh E. Making Learning a Game Introduction. As a university lecturer I enjoy playing games with learning goals in mind. My students are all adults who work in many different roles. ... Their needs include learning how to design activities that will support acquisition of practical skills, extend personal understanding of emotional factors, and improve awareness of factors ­ such as economic, ecological and political aspects of society. ... Play. ...

Еще в разделе: (Показать все результаты (>9) - e-journal.spa.msu.ru/ )

CRIMEAN FIELD GEOLOGICAL CAMP, FIRST YEAR (1st CRIMEAN) . First Crimean Field Camp is organized for the MSU Geological Faculty first year students. ... Professors and researchers from Dynamic Geology Department of Geological Faculty and Russian Academy of Science Institute of Geology are leadind the students. ... SHORT HISTORY OF THE 1st CRIMEAN . ... The main goal of the field camp is to show students how geological processes work now and what we can learn about them in the past. ...

Еще в разделе: (Показать все результаты (>14) - dynamo.geol.msu.ru/ )

• http://dynamo.geol.msu.ru/personal/vsz/papers/Zakharov_2011_2_eng.pdf
• http://dynamo.geol.msu.ru/personal/vsz/papers/Zakharov_2013_3_eng.pdf

... Abstract A Uniform Resource Identifier (URI) is a compact string of characters for identifying an abstract or physical resource. ... This document defines a grammar that is a superset of all valid URI, such that an implementation can parse the common components of a URI reference without knowing the scheme-specific requirements of every possible identifier type. ... URI-reference = [ absoluteURI | ... Otherwise, the reference URI's scheme is inherited from the base URI's scheme component. ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1808.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2068.txt

... Instr. and Meth. in Phys. Res. ... Design considerations The requirements of the physics to be studied and the geometric constraints imposed by the experimental setup led us to adopt the following design criteria: (i ) To ensure good particle-track definition, the chamber had to have at least four layers of sense wires. ... Chamber description TCYL is a drift chamber with four layers of sense (anode) wires strung axially along cylindrical surfaces surrounding the liquid H, target (see Fig. ... Res. ...

Еще в разделе: (Показать все результаты (>35) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/nir/papers/NIM_Unique-Sci-D.pdf
• http://lav01.sinp.msu.ru/nir/papers/NIM_3000-LGD.pdf
• http://lav01.sinp.msu.ru/~vlk/report01_wl.ps

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>47) - sn.sai.msu.ru/ )