ISSN 0026-2617, Microbiology, 2008, Vol. ... Key words: late stationary phase, secondary growth, Pseudomonas aeruginosa, S and M dissociants, population structure of the culture. ... Growth dynamics and population composition of a mixed culture of P. aeruginosa S and M dissociants in the variant of autolysis in the late stationary phase: optical density, OD з 100 (1); ratio of the M dissociant in the population, % (2); pH (3); and content of reducing sugars, mg % (as glucose) (4). ...

Еще в разделе: (Показать все результаты (>13) - dis.bio.msu.ru/ )

Contents Curricula, and Programs. Mathematical Analysis. (The Program of Mathematical Physics Department).............................................. Algebra and Analytical Geometry.(The program of (General "Mathematics" Department)................................ Computer and Programming. (The program of Algorithmic Languages Department).................................... The practical work on Computers.( Department of Algorithmic. Languages)............................................... Discrete

Еще в разделе: (Показать все результаты (>53) - mph.cmc.msu.ru/ )

• MPH-CMC-MSU

Home Search Collections Journals About Contact us My IOPscience On the Routh sphere problem This content has been downloaded from IOPscience. ... 2013 J. Phys. A: Math. ... It allows us to relate the nonholonomic Routh system with the Hamiltonian system on a cotangent bundle to the sphere with a canonical Poisson structure. ... If the Hamiltonian vector field X has the form (1.4) with respect to the second Poisson bivector, we have the so-called quasi-bi-Hamiltonian system. ... 4 J. Phys. A: Math. ...

Еще в разделе: (Показать все результаты (>137) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/972/RCD752.pdf
• http://ics.org.ru/upload/iblock/efa/rm_70_1167.pdf
• http://ics.org.ru/upload/iblock/250/188-an-extended-hamilton-jacobi-method_ru.pdf

My colleagues and I have recently completed a series of observations of SN1999an. ... The telescope is located at Martin Observatory in Blacksburg, VA, and is operated by the Physics Department of Virginia Tech. Our IAU Minor Planet Center Observatory Code is 841. ... Attached you will find a copy of one of our images (in .jpg format) with the supernova indicated. ... Virginia Tech Department of Physics . Back to Bright Supernovae . Back to Supernova 1999an . ...

Еще в разделе: (Показать все результаты (>7) - www.rochesterastronomy.org/ )

... Parent Directory / . Directory . Contents.pdf . 2011-Nov-01 17:40:03 . ... application/pdf . Introduction.pdf . ... Глава 1.pdf . ... 1.0M . ... lighttpd/1.4.39 ...

Еще в разделе: (Показать все результаты (>16) - ocean.phys.msu.ru/ )

• Index of /courses/stathyd/book by Nosov/

... Living systems depository "Noah's Ark" . ... Home . ... Main grant . Current results . Scientific results . Publications . ... Animals . ... You can find the complete list of publications on the page of the grant in "Istina" system. Selected publications: . ... Moscow, 119991, . ... 7 (495) 939-10-00 . ...

Еще в разделе: (Показать все результаты (>15) - depository.msu.ru/ )

• depozitariy | Living systems depository "Noah's Ark"

... Музей . антропологии . ... Вестник МГУ Антропология . ... Серия XXIII. ... 125009, г. Москва, ул. Моховая, д. 11, НИИ и Музей антропологии МГУ, комн. ... Другим известным деятелем, оказавшим большое влияние на развитие отечественной антропологии, был профессор географии Московского университета Д.Н. Анучин. ... 2008-2010 Научно-исследовательский институт и Музей антропологии им.Д.Н.Анучина . Копирование материалов web-сайта только с разрешения администрации НИИ и Музея антропологии МГУ! ...

Еще в разделе: (Показать все результаты (>28) - www.anthropos.msu.ru/ )

• НИИ и Музей антропологии | Вестник Московского университета. Серия XXIII.

Общее . ... Геология в Московском университете . ... Профком геологического факультета . ... Геологический факультет МГУ всемирно известный учебно-научный центр России. ... Вся деятельность сотрудников факультета направлена на развитие геологической науки, образования и культуры необходимых условий экономического и духовного возрождения России. ... 119991, Российская Федерация, Москва, ГСП-1, Ленинские горы, Московский государственный университет имени М.В. Ломоносова, Геологический факультет, . ...

Еще в разделе: (Показать все результаты (>8) - geol.msu.ru/ )

Oceanology, Vol. ... MARINE BIOLOGY A Comparative Study of the Primary Production in the Norwegian Sea by Different Methods V. V. Sapozhnikov*, V. B. Goryunova*, B. A. Levenko**, L. E. Dulova***, T. K. Antal**, and D. N. Matorin** * All-Russia Research ... Microbiology, Russian Academy of Sciences, Moscow, Russia Received December 1, 1998; in final form, March 1, 1999 Abstract--The results of primary production measurements obtained by different methods are presented ... OCEANOLOGY Vol. ...

Еще в разделе: (Показать все результаты (>39) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/matorin/3398.pdf
• http://library.biophys.msu.ru/matorin/3397.pdf
• http://library.biophys.msu.ru/matorin/3379.pdf

... Cell il., ... 219-235 Reprints available directly from the publisher Photocopying permitted by license only © 2000 OPA (Overseas Publishers Association) N.V. Published by license under the Harwood Academic Publishers imprint, part of The Gordon and Breach Publishing Group Printed in Singapore -Tubulin Distribution in Interphase and Mitotic Cells upon Stabilization and Depolymerization of Microtubules I. A. Vorobjev*, R. E. Uzbekov, Yu. ... EXPERIMENTAL Cell cultures. ... 1993, J. Cell Sci. ...

Еще в разделе: (Показать все результаты (>38) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/alieva94.pdf

Series on Stability, Vibration and Control of Systems, Series A - Vol. ... MULTIPARAMETER STABILITY THEORY WITH MECHANICAL APPLICATIONS . ... This book deals with fundamental problems, concepts, and methods of multiparameter stability theory with applications in mechanics. ... Introduction to Stability Theory . ... Read Full Review . ... Since Bolotin's pioneering book on nonconservation problems on the theory of elastic stability, not many books appeared at such a high level, such as this one. ...

Еще в разделе: (Показать все результаты (>32) - mailybaev.imec.msu.ru/ )

• Book review by Professor Wolfhard Kliem

... Find the Brillouin zone for a 2D honeycomb lattice (lattice parameter d) and transform it into a hexagon. ... Compare the energies and the RMS charge radii electrons, in units of e). 1 2 (r )d3 x thus obtained ((x) is the total charge density of two 4. Find the density profile n(r) for an atom with the nucleus charge -Z e using the Thomas­ Fermi equation. ... Introducing the wavefunction (x) containing the low-energy degrees of freedom, find the effective wave equation for it. ...

Еще в разделе: (Показать все результаты (>13) - theorphys.phys.msu.ru/ )

Control of Diffeomorphisms and Densities Andrei A. Agrachev SISSA, Trieste, Italy and Steklov Mathematical Institute, Moscow, Russia e-mail: agrachev@sissa.it Consider a classical control system as it was defined by Pontryagin: x = f (x, u), x M , u U. (1) Assume that the state space M is a smooth manifold , the set of control parameters U is a closed subset of another smooth manifold , the righthand side f is ...

Еще в разделе: (Показать все результаты (>34) - pont2008.cmc.msu.ru/ )

• http://pont2008.cs.msu.ru/files/en/abstracts/Gamkrelidze.pdf
• On mathematical creative work of L.S. Pontryagin (By D.V. Anosov) International

Disjoining pressure of an electrolyte film confined between semipermeable membranes Salim R. Maduar and Olga I. Vinogradova Citation: The Journal of Chemical Physics 141, 074902 (2014); doi: 10.1063/1.4892758 View online: http://dx.doi.org/10.1063/1.4892758 View Table of Contents: http://scitation.aip.org/content/aip/journal/jcp/141/7?ver=pdfcov Published by the AIP Publishing Articles you may be interested in Order of wetting transitions in electrolyte solutions J. Chem. ... Chem.- ... Phys. Commun. ...

Еще в разделе: (Показать все результаты (>59) - nanofluidics.phys.msu.ru/ )

• Teaching
• Laboratory of Micro- and Nanofluidics

... О хоре . История хора . ... Выступление Академического хора МГУ в Крокус Сити Холле . ... Епископ Тихон открыл выступление хора МГУ в Вене . Хор МГУ выступил в Венском отделении ООН . Выступление хора на торжественном открытии Международного научного конгресса ?Глобалистика ? 2015? ... Академический хор Московского государственного университета имени М. В. Ломоносова . ... Прослушивания состоятся в течение всего сентябряљв 311 и 316 классах Культурного центра МГУ в 18-30 . ...

Еще в разделе: (Показать все результаты (>2) - choir.msu.ru/ )

. Moscow State University . INTERNATIONAL CONFERENCE . H YDRODYNAMIC I NSTABILITY AND T URBULENCE . February 24 ? March 02 , 2008 . Moscow, Russia . Call For Papers Информационное письмо . Author instructions . Abstract example Paper example . Location (More information) . Conference Program Posters . E-mail : gertsens@imec.msu.ru . Institute of Mechanics, Lomonosov Moscow State University . Aerodynamical Installations . Moscow Sights & Attractions

Еще в разделе: (Показать все результаты (>31) - hit-conf.imec.msu.ru/ )

Electronic Proposal Submission Service - EPSS preparation and submission guide - Release Date: 5 May 2008 Table of Contents 1 1 .1 . ... Using PIC in EPSS.. ... 29 EPSS help desk Phone: +32 2 23 33 760 Email: support@epss-fp7.org EPSS User Manual Released on 5 May 2008 page 2 of 29 1 EPSS Preparation ­User's Guide The EPSS (Electronic Proposal Submission Service) allows Proposers to create their proposal completely on-line without downloading or saving anything on their local personal computer. ...

Еще в разделе: (Показать все результаты (>32) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/ERC_rules.pdf
• http://ideas.msu.ru/docs/CSA_guide_2008.pdf
• http://ideas.msu.ru/docs/fp7_rules.pdf

... The Informativeness of Coherence Analysis in EEG Studies A. P. Kulaichev UDC 612.821.6 Translated from Zhurnal Vysshei Nervnoi Deyatel'nosti imeni I. P. Pavlova, Vol. ... KEY WORDS: coherence, spectral analysis, EEG non-stationarity, amplitude modulation. ... In particular, the two fundamental differences between EEG signals and most other physical signals are not considered: a) fundamental non-stationarity; b) amplitude modulation at all frequency ranges. ... Coherence in technical addenda. ...

Еще в разделе: (Показать все результаты (>14) - www.protein.bio.msu.ru/ )

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Подписаться на новости . ... Computer Science . ... Software engineering for mobile devices . ... Design and development of middleware (collaboration system, context-aware system, content system) on mobile devices . Design and development of applications on mobile devices . ... 2) Embedded OS porting, system programming, Mobile OS . ... 5) Location-based service on mobile devices . ...

Еще в разделе: (Показать все результаты (>114) - www.physcareer.ru/ )

• Sales Operations Intern (Student) / Вакансии / Physcareer.ru
• Software Engineer (Server) / Вакансии / Physcareer.ru
• Software Engineer (Backend Servers / Web / WAP / Вакансии / Physcareer.ru

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf