. SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>275) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• ETS numeration assumed

At present time when a new generation of TeV energy colliders is beginning to operate one needs to calculate cross sections for a great number of various reactions. ... The main idea in CompHEP was to enable one to go directly from the lagrangian to the cross sections and distributions effectively, with the high level of automation. ... Code for UNIX (date 22.6.2000.) ... We present a new version of CompHEP which can operate with SUSY Lagrangian and generate a flow of unweighted events. ...

Еще в разделе: (Показать все результаты (>2489) - theory.sinp.msu.ru/ )

• Reduce program
• [RU-NGI] Fwd: [Noc-managers] EGI SVG Advisory 'High' RISK - DPM version in EPEL
• Install

... Methylene selectivity in microemulsion liquid chromatography . Abstract The example of the chromatographic analysis of a mixture of benzene homologs in a MELC mode with different surfactants showed that the dependence of the retention of the number of methylene groups has a convex character that is fundamentally different from the normal mode of reversed-phase HPLC, where the relationship is exponential. ... Moscow University Chemistry Bulletin . 2015, Vol. ... Copyright (C) Chemistry Dept., ...

Еще в разделе: (Показать все результаты (>688) - chem.msu.ru/ )

• Molecular mechanics calculations of beta-diketonate, aqua, and
• Moscow University Chemistry Bulletin Vol. 42, No. 4 (2001)
• Moscow University Chemistry Bulletin Vol. 53, No. 6 (2012)

The Status popup displays useful information about the state of sets, regions, and graphs. ... When the number of sets is less than 30, this button is not needed, use the scroll bars to view the status of the sets that are not shown in the display. ... Operations in the Status popup are performed by clicking on the operation, then clicking on one or more set numbers shown in the display. ... Clicking on Copy followed by clicking on a set number in the scrolled window will select the set to copy from. ...

Еще в разделе: (Показать все результаты (>633) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~polar/xmgr/sets.html
• http://xray.sai.msu.ru/~ivan/gmt/man/gmtmath.html
• http://xray.sai.msu.ru/~ivan/gmt/man/filter1d.html

... О UNИX . ... Неизменяемая страница . ... Processing Instructions . ... redirect . ... pragma . ... deprecated . ... MoinMoin processing instructions have the same semantics as in XML: they control the paths taken when processing a page. ... For more information on the possible markup, see HelpOnEditing . Processing instructions MoinMoin knows of: . ... Redirect to a different page (see PageRedirect ) #REDIRECT pagename . ... Sets processing modes for this page: #PRAGMA mode arguments . ...

Еще в разделе: (Показать все результаты (>309) - uneex.mithril.cs.msu.su/ )

• HelpOnLists - UNИX
• HelpOnHeadlines - UNИX
• HelpOnParsers/ReStructuredText/RstPrimer - UNИX

... NetCDF User's Guide for C . This appendix specifies the netCDF file format version 1. ... NC_VARIABLE nelems [var .. ... 4344 4601 0000 0000 0000 0000 0000 0000 C D F 001 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 17220 17921 00000 00000 00000 00000 00000 00000 [magic number ] [ 0 records ] [ 0 dimensions (ABSENT) ] 0000 0000 0000 0000 0000 0000 0000 0000 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 00000 00000 00000 00000 00000 00000 00000 00000 [ 0 global atts (ABSENT) ] [ 0 variables (ABSENT) ] . ...

Еще в разделе: (Показать все результаты (>59) - angel.cs.msu.su/ )

... Annex (e.g. 3.1) (3) Paragraph/ Figure/Table/ Note (e.g. Table 1) 4 Type of comment2 5 Comment (justification for change) by the MB Date: (6) Document: (7) Secretariat observations on each comment submitted Proposed change by the MB RU RU RU RU 2 2 2 2 Row 2 Row 4 Row 4 Row 5 ed ed ed te SEPs are not fluxes , but particles It is desirable to add that Wolf number is also known as the sunspot number. ... CLOSED: Accepted and implemented in modified form CLOSED: Accepted and RU 2 Row 16 . ...

Еще в разделе: (Показать все результаты (>9) - srd.sinp.msu.ru/ )

New GCVS Versions for Three Southern Constellations Peremennye Zvezdy (Variable Stars) 27, No. ... We are currently working on a version of the General Catalogue of Variable Stars (GCVS) revised taking into account the new data accumulated since the 4th GCVS edition. ... It will contain all stars of the 4th GCVS edition plus a complete catalogue of the stars added to the GCVS in the Name Lists of Variable Stars Nos. ...

Еще в разделе: (Показать все результаты (>112) - sai.msu.ru/ )

• Future Prospects of Variable-Star Catalogues

... A Backward Sunspot and the New Solar Cycle . ... Credit: MDI , SOHO , ESA , NASA Explanation: Why is sunspot 905 backwards? Perhaps it is a key marker for the beginning of a new magnetic cycle on our Sun . Every 11 years, our Sun goes through a magnetic cycle , at the end of which its overall magnetic orientation is reversed. ... Just now, the Sun is near Solar Minimum , and likely to start a long progression toward the most active time, called Solar Maximum , in about 5.5 years. ...

Еще в разделе: (Показать все результаты (>7661) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > Англо-Русский Словарь
• Астронет > A Backward Sunspot and the New Solar Cycle

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>25) - cdfe.sinp.msu.ru/ )

• CDFE provides the major photonuclear databases. Online Services.
• CDFE => Online Services => Relational ENSDF

... LENGTH: The written version is significantly shorter: the number of clauses in it is 1.5 times less than in the spoken version. 1) Spoken: This story is about a small eagle. ... Then the egg moved again. ... LENGTH OF SENTENCES: Written sentences are shorter than spoken sentences: the mean number of clauses in the former is 1.9, in the latter 2.2. ... MORPHOSYN TACTIC PHENOMENA Number of preverbal full NPs in clause, % No full NPs One full NP Two full NPs 62 35 3 53 43 4 Spoken Written Table 2. ...

Еще в разделе: (Показать все результаты (>397) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~languedoc/tools/text-conv/interlinear-span-to-office.xsl.txt
• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.doc
• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.pdf

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Foreign Chinese number and be the Vuitton . ... a href=http://celinesale.zohosites.com/><b>Celine bags</b></a> The name of this company is Eurohandbag and is considered to be the best provider of Hermes bag in the entire hand bag market.. ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>11382) - www.sevin.ru/ )

• ОБН РАН.Каталог журналов
• Экологический Форум - Фундаментальная Экология: watches yachts seize number
• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): Site News: Site

... 1 allpy ( 1 . ... 5 -- Danya Alexeyevsky < dendik @ kodomo . fbb . msu . ... 9 * blocks3d - wt : create / var / run / wt by initscript , as required by new Debian policy . ... 34 * Fixed debian / changelog . ... 40 * New allpy release . ... 53 * geometrical - core depends on particular version of python - allpy ( > = 1 . ... 87 * Debianized blocks3d , blocks3d - wt ; fixed debian dependencies for . 88 python - allpy where necessary . ... 102 -- Danya Alexeyevsky < dendik @ kodomo . ...

Еще в разделе: (Показать все результаты (>31617) - kodomo.fbb.msu.ru/ )

• allpy: af89511a78ff NEWS
• allpy: e71155b99511 debian/changelog
• Help: revsets

... Manuscript Submission . Publication Procedure . ... After the refereeing process is complete, the manuscripts may be declined or returned to the authors for revisions, or accepted for publication. ... The best way to learn how to format the manuscript is to look at several papers already published in the journal. ... Moscow: Moscow University Press, 1969. ... The manuscript of the manuscript> is submitted for publication in the on-line journal "Vychislitel’nye Metody i Programmirovanie". ...

Еще в разделе: (Показать все результаты (>337) - num-meth.srcc.msu.ru/ )

• Intermittency of vector fields and natural random number generators
• Contents.Volume 17
• Composition of infinitary structures

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>143) - bioinf.fbb.msu.ru/ )

• SDPlight
• Input Formats

... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>157) - www.psy.msu.ru/ )

... a6blp : Замена hdd в ноуте. ... 1 Raw_Read_Error_Rate 0x000f 119 083 034 Pre-fail Always - 232103045 . 3 Spin_Up_Time 0x0003 099 099 000 Pre-fail Always - 0 . 4 Start_Stop_Count 0x0032 097 097 020 Old_age Always - 3179 . 5 Reallocated_Sector_Ct 0x0033 094 094 036 Pre-fail Always - 129 . 7 Seek_Error_Rate 0x000f 067 059 030 Pre-fail Always - 313879468641 . 9 Power_On_Hours 0x0032 079 079 000 Old_age Always - 18748 (245 201 0) . ...

Еще в разделе: (Показать все результаты (>7462) - www.fds-net.ru/ )

• Продам комп за 1к (пойдет для сервака) - Public forum of MSU united student
• Pink Floyd - The Wall DVD-version - Public forum of MSU united student networks
• ICQ number!? - Public forum of MSU united student networks

... Screening pattern or alignment against protein databank . ... SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Unitary Dayhoff Blosum 30 Blosum 50 Blosum 62 Johnson . ... Pattern Alignment . Pattern (or alignment) . Pattern example 1: . ... FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>233) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services Help
• GeneBee BLAST 2.2.22+ Services Help
• Screening protein sequence against PROSITE databank

... More Reports . ... Variety of long-eared owls (Asio otus) diet, as index of habitat usefulness // Mobility of students and programmes flexibility in the prospect of the European unification of the training processes in ecology and environmental science. ... Long-eared owl A.otus rather actively masters anthropogenous landscapes. In this connection it is interesting to observe change of various aspects of ecology of this species, in particular, dynamics of its food objects. ...

Еще в разделе: (Показать все результаты (>622) - vertebrata.bio.msu.ru/ )

• Выступления студентов и аспирантов на конференциях

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... This is a modification of the original Camera Calibration Toolbox for Matlab by Jean-Yves Bouguet that adds automatic calibration object detection to the functions of the original toolbox. ... The source code can be downloaded lower in this page. v0.31b Download GML Matlab Camera Calibration Toolbox 0.31 11.05.2005 Re-compiled and added correct OpenCV dlls . ... C++ Camera Calibration Toolbox . ...

Еще в разделе: (Показать все результаты (>229) - graphics.cs.msu.ru/ )

• GML MatLab Camera Calibration Toolbox | Лаборатория компьютерной графики и
• Video Frame Rate N-Times Up-Conversion | Graphics and Media Lab