AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>153) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee
• Bioinformatics portal, Moscow State University

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>69) - www.prof.msu.ru/ )

This is a comparison of the deb, rpm, tgz, slp, and pkg package formats, as used in the Debian, Red Hat, Slackware, and Stampede linux distributions respectively (pkg is the SVr4 package format, used in Solaris). ... signed packages . yes[ 1 ] . ... Recognising that it's important sometimes to be able to peer inside packages without using their package managers, this section compares how the various packages can be processed with tools available on any linux system [ 3 ]. recognizable by file . ...

Еще в разделе: (Показать все результаты (>242) - uneex.lorien.cs.msu.su/ )

• Other Build-related Commands
• mod_ldap - Apache HTTP Server
• The Edit Menu

Nucleotide sequence of the bioH gene of Escherichia coli" . ... The complete genome sequence of Escherichia coli K-12' . ... The 4,639,221-base pair sequence of Escherichia coli K-12 is presented. ... Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110' . ... With the goal of solving the whole-cell problem with Escherichia coli K-12 as a model cell, highly accurate genomes were determined for two closely related K-12 strains, MG1655 and W3110. ...

Еще в разделе: (Показать все результаты (>2832) - kodomo.cmm.msu.ru/ )

• compare
• Help: diff

... In order to compare the number of different evolutionary stages obtained and X-ray luminosity of the chosen X-ray sources with the observed galactic values we use the sum of C/O+O/C , where C and O are the calculated and observed values of a given binary type, respectively. If we make comparison for a number of different binary species (for example, we compare the number of CV, number of X-ray pulsars,   total X-ray luminosity of LMXB, etc.), we write this criterion in the form: . ...

Еще в разделе: (Показать все результаты (>322) - xray.sai.msu.ru/ )

• Basic Observational Data for Determination of f(q) and

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . ... Войти в систему . ... Создать обращение в службу поддержки пользователей . ...

Еще в разделе: (Показать все результаты (>1322) - istina.msu.ru/ )

• Aoki Y. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Zentralblatt f?r Bakteriologie, Mikrobiologie und Hygiene. 1. Abt. Originale B,
• Communications in behavioral biology. Part A: [Original articles] - журнал |

... Главная -> Фильмы -> Original Gangstas . ... Фильмы . ... Original Gangstas . США 1996 . ... Jim Brown . ... Oscar Brown Jr. ... Linda Marie Bright . ... Anthony Snowden . ... Bushwick Bill . ... The Bishop Don Magic Juan . ...

Еще в разделе: (Показать все результаты (>329) - kinfo.ru/ )

• The Original Latin Kings of .. - Фильмы - Kinfo.ru
• The Original Movie. - Фильмы - Kinfo.ru
• Original Sin - Фильмы - Kinfo.ru

... MPI_Group_compare . ... All MPI routines in Fortran (except for MPI_WTIME and MPI_WTICK ) have an additional argument ierr at the end of the argument list. ierr is an integer and has the same meaning as the return value of the routine in C. In Fortran, MPI routines are subroutines, and are invoked with the call statement. ... All MPI routines (except MPI_Wtime and MPI_Wtick ) return an error value; C routines as the value of the function and Fortran routines in the last argument. ... Центры . ...

Еще в разделе: (Показать все результаты (>292) - www.parallel.ru/ )

• MPI_Comm_compare | PARALLEL.RU - Информационно-аналитический центр по
• Communicators | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Basic Fortran Support | PARALLEL.RU - Информационно-аналитический центр по

... Полная версия этой страницы: 'Crossed-Field' and 'EH' Antennas . Студенческий форум Физфака МГУ > Наука физика > Интересные задачи и познавательные вопросы . ... the square of the peak (electric or magnetic) dipole moment of the antenna. ... case of a linear (electric) antenna, and is the product of the peak current times the area . of the antenna in the case of a loop (magnetic) antenna. ... One suggestion for a small antenna is the so-called 'crossed-field' antenna [2]. ... Developer . ...

Еще в разделе: (Показать все результаты (>207) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > 31 декабря - ORIGINAL NEW YEAR! Клуб Plan B

... INSERT operations into very simple tables with few columns and keys. ... Tables with variable-length strings, since MySQL has more efficent handling and can have indexes on VARCHAR columns. ... We know that mSQL has a JDBC driver, but we have too little experience with it to compare. ... To get some perspective on this, you can view the mSQL `HISTORY' file for the last year and compare it with the News section of the MySQL Reference Manual (see section D MySQL change history ). ... Column types . ...

Еще в разделе: (Показать все результаты (>238) - itpm.msu.su/ )

• MySQL Reference Manual for version 3.23.10-alpha. - E Known errors and design
• mod_ldap - Apache HTTP Server
• Ethernet Interfaces

... USE OF A NEW VERSION OF COMAGMAT TO MODEL SULPHIDES IN GABBRONORITIC MELTS AND OL CUMULUS PILES Alexey Ariskin Kirill Bychkov 1 2 2 Leonid Danyushevsky Galina Barmina 1 1. ... CODES, University of Tasmania In an accompanying paper we presented a new version of the COMAGMAT magma crystallization model [1-3] allowing one to model various sulfide-silicate assemblages [2] and the effect of NiO content in the melt on SCSS, silicate minerals and sulphide compositions [3]. ... 4] Ariskin et al. ...

Еще в разделе: (Показать все результаты (>326) - geo.web.ru/ )

• http://geo.web.ru/COMPASS/team.html
• http://geo.web.ru/~ariskin/docs/papers/p96_039.pdf
• http://geo.web.ru/conf/alkaline/2009/ZaitsevV4.htm

... A dual-beam thermal lens spectrometer is used as a detector in HPLC. ... A comparison of the methods for calculating the performance characteristics from peak heights (conventional approach) and peak areas showed that the latter variant gives more reliable results. ...

Еще в разделе: (Показать все результаты (>511) - chem.msu.ru/ )

• Determination of Reaction Rate Constants in Micelles. A Comparison of the
• Moscow University Chemistry Bulletin Vol. 53, No. 4, P. 272 (2012)
• Moscow University Chemistry Bulletin Vol. 54, No. 5, P. 295 (2013)

Recent Results on Adaptive Track and Multitrack Fitting in CMS R. FrЭhwirth (HEPHY Vienna) A. Strandlie ( CERN ) T. Todorov (IReS Strasbourg) M. Winkler ( CERN ) Are Strandlie , CERN ACAT 2002 , Moscow Outline Adaptive algorithms - a brief review Results - simulation study in ATLAS TRT Results - simulation study in CMS tracker Conclusions Are Strandlie , CERN ACAT 2002 , Moscow ... Are Strandlie, CERN ACAT 2002, Moscow ...

Еще в разделе: (Показать все результаты (>52) - acat02.sinp.msu.ru/ )

... Продам 2 планки DDR2 PC6400 1GB Samsung original . ... Samsung 1GB 2Rx8 PC2-6400U (800 MHz) . ... Re: Продам 2 планки DDR2 PC6400 1GB Samsung original [ re: Stas ] . ... Re: Продам 2 планки DDR2 PC6400 1GB Samsung original [ re: holod ] . ... Re: Продам 2 планки DDR2 PC6400 1GB Samsung original [ re: Ermak ] . ... ну...вообще говоря, там Original SAMSUNG DDR-II DIMM 1Gb PC2-6400 $34.3 . ... и у тебя Original? гарантия тоже присутствует? ...

Еще в разделе: (Показать все результаты (>1562) - www.snto-msu.net/ )

• [продам] Кофе зерновой Paulig Espresso Originale, 1кг - Public forum of MSU
• Куплю кабель Nokia CA-42 Original - Public forum of MSU united student networks
• [продам] 2+ярусная деревянная кровать IKEA - Public forum of MSU united student

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>10) - imaging.cs.msu.ru/ )

... 2010-05-05 05:06 . 1.3K . ...

Еще в разделе: (Показать все результаты (>175) - herba.msu.ru/ )

• Bulletin of Moscow Society of Naturalists. Biological series.
• The behavior of Nymphaea flowers
• New Page 1

Diploma thesis abstract Dmitry V. Khakhulin Scientific Advisor Dr. Roman V. Volkov Defense date: December 22, 2006 Efficient Conversion of Subterawatt Radiation of Ti:Sapphire Laser System into Wavelength Range 300­400 nm. ... The first, direct supercontinuum generation in fused silica and LiF under the influence of second harmonic radiation of Ti:Sapphire laser system. ... Subsequent generation of second harmonic from amplified supercontinuum radiation carried out in 1 mm thickness BBO crystal. ...

Еще в разделе: (Показать все результаты (>206) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2014/Kimberg_Brandt_en.pdf

... Technique of supervision of solar atmosphere active formations with the Multichannel Flare Spectrograph. Consider in details now a method of observations of fast processes in solar chromosphere with Multichannel Flare Spectrograph (MFS) installed in Ondrejov Observatory (Czech Republic). ... The working spectral range lies between IR CaII 8542 A and K CaII 3870 A. To observe solar image on the spectrograph's slit a lens, narrow-band H-alpha filter (4) ("Daystar") and CCD-chamber are used. ...

Еще в разделе: (Показать все результаты (>170) - lnfm1.sai.msu.ru/ )

• Trudy GAISH, vol. LXV, 1996, Abstracts in English

... The objects on the surface may be searched and then enumerated using the Command Enum Features . ... The average level, mean square deflection (in fig d) and maximum value are calculated for the surface. ... The new average level of the height of the surface is found when the selected objects are not accounted for. Then the average height of each selected objects is calculated as the average value among maximum values of the height for each line along X axis in respect to the new average level. ...

Еще в разделе: (Показать все результаты (>72) - www.spm.genebee.msu.ru/ )

• Change in inner data representation
• Изменение внутреннего представления данных

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... продам] Кофе зерновой Paulig Espresso Originale, 1кг . ... Re: [продам] Кофе зерновой Paulig Espresso Originale, 1кг [ re: demonnet ] . ...

Еще в разделе: (Показать все результаты (>2623) - www.fds-net.ru/ )

• Куплю кабель Nokia CA-42 Original - Public forum of MSU united student networks
• Original IntellijIDEA license ? - Public forum of MSU united student networks
• DotA vs. War3 (original) - Public forum of MSU united student networks