... Information for the applicants . ... News . ... The Faculty of Bioengineering and Bioinformatics, Lomonosov Moscow State University was founded in 2002 with the express purpose of training of highly qualified personnel for the universities, research institutes, medical companies and facilities, and pharmaceutical and biotechnology industries. ... Faculty of Bioengineering and Bioinformatics, office 433. ... 2016 Faculty of Bioengineering and Bioinformatics, . Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>2) - en.fbb.msu.ru/ )

• New documents? Faculty of Bioengineering and Bioinformatics, MSU

Справочники по истории на русском языке в Интернете . ... Хотя мы считаем, что на нижеперечисленных сайтах собрана полезная информация, . ... Хронологические таблицы по истории Азии I-XVIII вв. на Центральноазиатском историческом сервере . ... статьи из Брокгауза и Ефрона . ... Малый энциклопедический словарь Брокгауза и Ефрона также на разных сайтах: . ... Информация о руководителях различных государств, ныне существующих и существовавших в истории. ... Справочник по истории Третьего Рейха . ...

Еще в разделе: (Показать все результаты (>3262) - hist.msu.ru/ )

• Project "The Labour Relations Evolution in Russian Industries"
• Internet-Heuristics for Historians: Course on Web Search and Data Retrieval.
• Moscow State University. Faculty of History. An Application

... Science . ... lrm@cs.msu.su . ... The Laboratory of Difference Methods was founded by A.A.Samarsky, Academician of RAS, in the middle of the 60s. For more than 50 years the Laboratory?s theoretical research has been focused on numerical methods for problems described by systems of partial differential equations. ... N.V.Ardelyan, V.L.Bychkov, I.V.Kochetov and K.V.Kosmachevskii, Non-self-maintained discharge plasma in propane-air mixture // IEEE Trans. on Plasma Science, vol. 39. no. 12, part 1, pp. ...

Еще в разделе: (Показать все результаты (>222) - en.cs.msu.ru/ )

• Information for foreigners who wish to study at our Faculty | CMC MSU
• Information for foreigners who wish to study at our Faculty
• Laboratory of Difference Methods

. A document to be published on the Web can include the following features: . Stylized text . Inline images . Links to other information . To assist the authors in writing Web pages, many useful utilities have been designed.

Еще в разделе: (Показать все результаты (>316) - chem.msu.ru/ )

• Basic information for foreign applicants to the Department of Chemistry,

University Satellites and . Space Science Education . General information Date and Location Objectives of the meeting Sponsoring Organizations International Advisory Committee Local Organizing Committee Deadlines Addresses Hotels & Accommodation Venue Visas Social Programme . ... contact Organizing Committee ( universat2006@srd.sinp.msu.ru ) as soon as possible. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>27) - cosmos.msu.ru/ )

• Space Scientific and Education project of Lomonosov Moscow State University

. [ <<Previous ] [ Index ] [ Next>> ]

Еще в разделе: (Показать все результаты (>36) - cellmotility.genebee.msu.ru/ )

• koluchki Untitled Document
• kust1 Untitled Document
• kust_x Untitled Document

. [ Войти ] . Главная -> Фильмы -> Wetback: The Undocumented Do.. Пользователи . Демо . Деньги . Фильмы . Форум . Wetback: The Undocumented Documentary . США 2005 . отметить . Документальный .

Еще в разделе: (Показать все результаты (>18) - kinfo.ru/ )

• Document of the Dead - Фильмы - Kinfo.ru
• February - Фильмы - Kinfo.ru

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt

. Расплывание волнового пакета из 100 волн в результате дисперсии.

Еще в разделе: (Показать все результаты (>75) - genphys.phys.msu.su/ )

... http://edu-cons.net/svpaper4/ 10.12.2009 Untitled Document Page 2 of 40 , : « » ; () , , ; . ... Nature News ( 23 Sep 2002 ), doi: 10.1038/news020923-4, News http://www.nature.com/news/2002/020923/full/news020923-4.html http://edu-cons.net/svpaper4/ 10.12.2009 Untitled Document Page 39 of 40 3. ... . ... 1999-2000. 6. .., .. `` '', , `` ``'''', 2002. http://edu-cons.net/svpaper4/ 10.12.2009 Untitled Document Page 40 of 40 http://edu-cons.net/svpaper4/ 10.12.2009 ...

Еще в разделе: (Показать все результаты (>127) - higeom.math.msu.su/ )

• Toric Topology (English)
• C*-algebras: Arrival
• C*-algebras and elliptic theory

. Лаборатория молекулярных пучков . Контакты . схема . фото . Copyright ї 2001-2006 Лаборатория молекулярных пучков .

Еще в разделе: (Показать все результаты (>17) - beams.chem.msu.ru/ )

((tr|Q9HWZ3:27.13469,(((((tr|Q97JG6:73.32871,sp|P52281:58.21097):22.08826, . (tr|Q8Y6Z1:50.97049,(tr|Q9KDW9:31.89890,(tr|Q99UH4:56.31642, . sp|P18156:43.43318):19.58605):11.29379):3.59077):71.07033, . (sp|Q51389:17.43830,((tr|Q8ZJK5:16.37272,sp|P11244:16.30590):17.93318, . sp|P44826:37.32225):18.11240):90.64721):85.73800, . tr|Q97P66:72.12900):67.97217,tr|P73809:39.02698):25.46760):7.46192, . ((tr|Q92ZW9:33.27410,tr|Q8UJW4:14.11857):8.47005, . sp|Q9L772:29.68911):15.56444,sp|P48838:30.29193); .

Еще в разделе: (Показать все результаты (>6) - bioinf.fbb.msu.ru/ )

... Кафедра . ... Сотрудникам кафедры . ... Сотрудники кафедры.. Фетисова Анна Михайловна . ... Фетисова Анна Михайловна (26.04.1988, г.Дубна), геолог, кандидат геолого-минералогических наук (2014), ассистент кафедры динамической геологии геологического факультета МГУ. Телефон: (495) 939-2033 . Факс: (495) 939-1154 . Адрес: 119234, Российская Федерация, Москва, Ленинские горы, МГУ имени М.В.Ломоносова, корп. А, Геологический факультет, кафедра динамической геологии . ...

Еще в разделе: (Показать все результаты (>18) - dynamo.geol.msu.ru/ )

... The documents on academic background should be translated into Russian and attested by the Russian Embassy in the country where the documents were issued, or by the Embassy of your country in Russia, or by a notary in Russia. Graduation certificate of the Center for International Education at MSU, or Preparatory Course at a state university in Russia, or Certificate of the Russian Language test and tests in Physics and Mathematics, . ... Russian Language Summer Program . ...

Еще в разделе: (Показать все результаты (>14) - foroff.phys.msu.ru/ )

Theory as a Lighthouse in the Electrochemical Ocean . In memory of Alexander M. Kuznetsov . ... Until his last days he continued to work on various aspects of charge transfer phenomena. ... In electrochemical kinetics the theory always outruns the experiment, and the quantum mechanical theory of charge transfer created in the famous Theoretical Department of the Frumkin Institute in Moscow (R.R. Dogonadze, A.M. Kuznetsov and co-authors) is a good example for that. ...

Еще в разделе: (Показать все результаты (>49) - electr003.chem.msu.ru/ )

• RADEN Data Bank

Title Should Be in Bold, 18-Point Type and Centered, Please Use Title Case Author name(s) [10-point type, centered, bolded] Author affiliation and full address (8-point type, centered, italicized) Author e-mail address: (8-point type, centered, italicized) Abstract: Indent left and right margins 0.5 in. (1.27 cm), justify the paragraph (on both right and left), and use the same font as in the body of the paper. ... 5] Author(s), "Title of paper," in Title of Proceedings, Name(s), ed(s)., ...

Еще в разделе: (Показать все результаты (>8) - iconolat13.phys.msu.ru/ )

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>6697) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• allpy: allpy/protein.py history

... These spectral characteristics compare with introduction (ВВЕДЕНИЕ) At last time many workers have studied thermal Rayleigh-Benard convection using numerical At last time many workers have studied thermal Rayleigh- Benard convection using numerical time many At last time many workers have studied thermal Rayleigh-Benard convection using numerical used spectral methods with periodic boundary conditions. ... In numerical simulations were derived secondary stationary, [pic] where ? ...

Еще в разделе: (Показать все результаты (>31) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2008/abstractEx.doc
• http://hit-conf.imec.msu.ru/2006/CD/PetrovaLI.doc
• http://hit-conf.imec.msu.ru/2006/Nezategi.doc

... Measurement of the MASS detectors parameters with mass program January 24, 2015 [112707] . MASS/DIMM electronics. ... Turbina-core(D): Dimm User Guide. ... N.Shatsky, V.Kornilov, The revision of the MASS/DIMM star catalogue. ... О.Возякова, В.Корнилов, Н.Шатский, Новое программное обеспечение прибора MASS/DIMM. ... V.Kornilov, N.Shatsky, S.Potanin, O.Voziakova, B.Safonov Preliminary results of astroclimate parameters measurements at the Sternberg 2.5m telescope installation site. ...

Еще в разделе: (Показать все результаты (>20) - curl.sai.msu.ru/ )

MetaFast : fast reference-free graph-based comparison of shotgun metagenomic data Sergey V. Kazakov1, Vladimir I. Ulyantsev1, Veronika B. Dubinkina2,3, Alexander V. Tyakht2, Dmitry G. Alexeev 1 2 3 2 ,3 ITMO University ... (State Un iversity), Dolgoprudny, Russia Since the emergence of high-throughput genomic sequencing technologies, a huge volume of data has been accumulated describing complex microbial communities ( microbiota ) ... Example of MetaFast output on a set of real data. ...

Еще в разделе: (Показать все результаты (>159) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/119.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/179.pdf