Next] [Previous] [Top] [Contents] [Index] [netCDF Home Page] [Unidata Home Page] . ... The Unidata Program Center has developed a units library to convert between formatted and binary forms of units specifications and perform unit algebra on the binary form. Though the units library is self-contained and there is no dependency between it and the netCDF library, it is nevertheless useful in writing generic netCDF programs and we suggest you obtain it. ... Celsius . ... nit (unit of photometry) . ...

Еще в разделе: (Показать все результаты (>30) - angel.cs.msu.su/ )

• Appendix D NetCDF 2 C Transition Guide

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>10) - oc.cs.msu.ru/ )

... Liyong Liu (NAOC) . Site testing on seeing conditions of the astronomical observatories over China are briefly reviewed, including Xionglong station of NAOC, Gaomeigu station of Yunnan Observatory, Delingha station of Purple Mountain Observatory. ... PDF [3.0€аMB] October 8, 09:55 10:20 . ... In this paper, we will review the site survey activities in the past years, and present the site-testing results on the Oma site, including cloud cover, seeing, water vapor, transparency and sky brightness. ...

Еще в разделе: (Показать все результаты (>30) - site2010.sai.msu.ru/ )

• The site testing programs in Antarctica and in Arctic
• Results of ELT site testing programs - I
• Results of ELT site testing programs - II

... Why do I see a string of "X"s (or "N"s) in my query sequence that I did not put there? ... BLAST (Basic Local Alignment Search Tool) is a set of similarity search programs designed to explore all of the available sequence databases regardless of whether the query is protein or DNA. ... Filters are used to remove low-complexity sequence because it can cause artifactual hits (please see Q: After running a search why do I see a string of "X"s (or "N"s) in my query sequence that I did not put there? ...

Еще в разделе: (Показать все результаты (>191) - www.genebee.msu.ru/ )

• GeneBee service
• science
• GeneBee BLAST 2.2.22+ Services Help

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>171) - tukachev.flogiston.ru/ )

• Category: Новости

... Use of Advanced Regular Expressions . Regular expressions (REs), unlike simple queries, allow you to search for text which matches a particular pattern. ... operators in regular expression searches. ; is used to indicate an "and" search. ... Foswiki strives to support as much as possible of the Perl syntax for regular expressions. Be warned, though, that Foswiki only guarantees to support a subset of regular expression syntax, as documented in Foswiki:Development.RegularExpressions . ...

Еще в разделе: (Показать все результаты (>7133) - wiki.cmc.msu.ru/ )

• SiteTools < System < Foswiki
• JQueryCycle < System < Foswiki
• EmptyPlugin < System < Foswiki

... and non-profit organizations over the last 10-15 year have been flooding the universities and institutions of the former soviet countries with recourses, both material and human and the United States are among those countries with Agency for International Development (USAID); Bureau of Educational and Cultural Affairs (BECA); Department of Education and Department of Defense ... Overall U.S. government funding for international exchanges has shrunk over the past few years. ...

Еще в разделе: (Показать все результаты (>165) - www.prof.msu.ru/ )

• The Fulbright Program in Russia
• Fulbright Program in Russia: Prospects and Problems of the Community of...
• ECA Alumni Small Grants Program

... Development of a computer-based information system for Russian folklore studies . Computer systems SKAZKA and SKAZKA-2 are developing by A.V. Rafaeva. The aim of this work is to make program tools for structural analysis of folktale plots and motives. ... 112 – 113; Rafaeva A.V. Analiz rodstvennykh otnoshenij s pomosh’ju sistemy SKAZKA (Analysis of Relate Terms with the Help of SKAZKA Program) // Problemy kompjuternoj lingvistiki: Sbornik nauchnykh trudov, 1. ...

Еще в разделе: (Показать все результаты (>8) - lcl.srcc.msu.ru/ )

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>11) - www.sciencepark.ru/ )

... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...

Еще в разделе: (Показать все результаты (>35) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/dimm_soft_description.pdf
• . The . MASS . Group .

Previous article . Next article . ... The ChromatoMod Program for the Retention Simulation in the Reversed-Phased Ion Pair HPLC . Abstract The software “ChromatoMod” for treatment of chromatographic data and modeling retention in the ion pair reversed-phased HPLC was developed. ... Moscow University Chemistry Bulletin . 2004, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>438) - chem.msu.ru/ )

• The ARGENT Program System: A Second-Generation Tool Aimed at Systematic Search
• Entrance Examinations
• Entrance Examinations - Preliminary Round

... Results . ... Functional scheme of information flows under model studies of biosystems structure. ... Members of the group together with other Institutes of the RAS and departments of different Ministries (Education and Sciences, Natural resources and Agricultural) have created the pilot versions of the basic WEB-oriented information systems, which are actively used by many users in the global net of Internet. ...

Еще в разделе: (Показать все результаты (>3212) - www.sevin.ru/ )

• Laboratories: Group for Bioinformatics and Modeling Biological Process:
• Экологический Форум - Фундаментальная Экология: Overloaded By Wedding Programs?
• Экологический Форум - Фундаментальная Экология: example, with Rolex, showing

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>21) - comphep.sinp.msu.ru/ )

• download:rn-070606 [CompHEP]

... Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . Program . The program of the conference comprises plenary talks (50 min), section talks (45 min and 20 min) and poster presentations. ... Patrial Differential Equations . ... Special session "Control and Optimization in Partial Differential Equations" . ... Combinatorial and Toric Topology . ...

Еще в разделе: (Показать все результаты (>44) - pont2008.cmc.msu.ru/ )

• Program Committee International Conference Differential Equations and Topology
• Abstracts International Conference Differential Equations and Topology
• Program Международная конференция Дифференциальные уравнения и топология ,

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Mosekilde E. Department of Physics, Technical University of Denmark, Kgs. ... The purpose of this talk is to demonstrate the essential role that nonlinear dynamic phenomena play in normal physiological regulation and in the development of various diseases. ... Regulation of pressures and flows in the individual nephron involves the interaction between the tubuloglomerular feedback mechanism (TGF) and the oscillatory response of the activated afferent arteriole. ... 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>99) - www.msm.biophys.msu.ru/ )

• Approved Presentations

... Moscow State University offers more than 500 Further Education programs which are different in their duration, subject area and students? workload. ... The full list of Further Education programs offered by all MSU faculties is presented on MSU website: http://www.msu.ru/study/dopobr/ . ... For the list of current MSU MBA programs and their descriptions, see http://www.msu.ru/study/dopobr/ . ... Programs: General MBA, Executive МВА, MBA in Production Management, MBA in Logistics. http://en.mgubs.ru/...

Еще в разделе: (Показать все результаты (>118) - www.msu.ru/ )

• School of Television
• PROGRAMS in English
• GENERAL PROGRAMS

... This applet generates an observing list based on an observer's location and time. ... To use this program, enter in your location, and the local times at which you wish to begin and end observing. The date you enter should correspond to the calendar day at the time at which you begin observing. For example, if you wish to observe from 9:37 PM October 23, 2007 until 3:21 AM October 24, 2007, you would enter 21:37 for the starting time, 03:21 for the finish time, and 10/23/2007 for the date. ...

Еще в разделе: (Показать все результаты (>23) - observ.pereplet.ru/ )

HUMANITARIAN ASPECTS OF TEACHING MATHEMATICS IN HIGHER SCHOOL Positselskaya L.N. (Moscow) There are considered goals of survey course on mathematics in higher school, its role in building up the scientific world outlook. It is pointed out the importance of analyzing of interdisciplinary connections of mathematics with other branches of knowledge. There is proposed general approach to programs f survey courses on mathematics for different specialities. ... 10, 2002, .137-139 , . ... 1.1 . ...

Еще в разделе: (Показать все результаты (>194) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc151149/eng.pdf
• MCE-2016
• Registration

... 24 months to develop your career in Finance and Marketing Departments in British American Tobacco; . ... We are looking for high calibre graduates to join a truly FAST -TRACK Management Trainee Programme. ... In Russia, Management Trainee programme exists since 1996, so we have a great pool both of experienced coaches and successful programme graduates. ... You can also read more about Finance, Marketing functions, Management Trainee Program itself, Selection Process on this microsite. ...

Еще в разделе: (Показать все результаты (>134) - www.physcareer.ru/ )

• Summer Internship Program with The Nielsen Company / Стажировки / Physcareer.ru
• HP Graduate Development Program 2010 / Вакансии / Physcareer.ru
• Campus Ambassador Program, компания AB InBev / Стажировки / Physcareer.ru