Charge and mass transfer across the metal -solution interface E. Gileadi School of Chemistry Tel-Aviv University, ISRAEL gileadi@post.tau.ac.il 1 Time-Resolved Kinetics · The idea of different time scales for electron transfer and solvent reorganization is inherent in the Marcus theory · The characteristic time for different processes is: Electron transfer Solvent reorganization 1 fs 1 ps (103 fs) Diffusion across the ... Ag + soln +e crys Ag 0 soln E0 = - 2.55 V vs. ...

Еще в разделе: (Показать все результаты (>112) - electr003.chem.msu.ru/ )

Netork Working Group Request For Comments: 606 L. Peter Deutsch PARC-MAXC December 1973 Host Names On-line Now that we finally have an about time to put an end to on the network must maintain host list for the use of its programs. official list of host names , it seems the absurd situation where each site a different, generally out-of-date, own operating system or user For example, each ... The function o f the host vis-a-vis the network ( user, server, TIP, etc.) ...

Еще в разделе: (Показать все результаты (>20558) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc606.txt
• http://mirror.msu.net/pub/gentoo-portage/app-backup/ccollect/ccollect-0.8.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc6919.txt.pdf

... Now let us consider that damping or amplitude of the signal like a natural index of a hypothetical inequality or mean between the action and reaction, or the kinetic and the potential energy of the system. The time between the action and the reaction must be different from zero. ... We can describe this behaviour in its simpler form by the oscillation of a balance with inertiality or sensitivity, that is to say, with a time of reaction for the operations of adding or removing weights. ...

Еще в разделе: (Показать все результаты (>405) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/RREPORTS/anisov_svoystva.pdf
• http://temporology.bio.msu.ru/EREPORTS/ptitsyn_research.pdf
• http://temporology.bio.msu.ru/EREPORTS/oleinik_the_problem.pdf

... Class . ... Provides an abstraction for multidimensional array access, some concrete implementations, and ways to view a MultiArray as if it had a different structure. ... This interface defines the services required by MultiArrayProxy to manipulate indexes and the dimensions of a MultiArray. ... In the following, we use the unadorned term "array" to mean the Java language construct, and the term "multidimensional array" for the mathematical abstraction modeled by the MultiArray class in this...

Еще в разделе: (Показать все результаты (>35) - angel.cs.msu.su/ )

... Accepted input types are: A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. ... Sequences are expected to be represented in the standard IUB/IUPAC amino acid and nucleic acid codes, with these exceptions: lower-case letters are accepted and are mapped into upper-case; a single hyphen or dash can be used to represent a gap of indeterminate length; and in amino acid sequences, U and * are acceptable letters (see below). ...

Еще в разделе: (Показать все результаты (>179) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.22+ Services Help
• AliComp - GeneBee Alignment Comparison Help

Nonlinear Dynamic Phenomena in Physiological Control Systems Mosekilde E. BioSim Coordinator EU Network of Excellence Department of Physics, Technical University of Denmark, Kgs. Lyngby, 2800, Denmark; e-mail: erik.mosekilde@fysik.dtu.dk The purpose of this talk is to demonstrate the essential role that nonlinear dynamic phenomena play in normal physiological regulation and in the development of various diseases. As an example we consider renal auto-regulation in normo- and hypertensive rats. ...

Еще в разделе: (Показать все результаты (>108) - www.msm.biophys.msu.ru/ )

• MSM 2007

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ­ computer related 1) · Perform simulation , create trajectory file · Calculate properties timestep by timestep 2) · Perform ...

Еще в разделе: (Показать все результаты (>24) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/kiselev.pdf
• Laboratory of Electrical Double Layer and Electrode Kinetics

Analysis of the ANTARES data for SN neutrino detection V. Kulikovskiy (MSU / INFN Genova) Hit counts in the detector. The number of hits ( hit counts ) in a time slice (104.8 ms) is used (this information is stored in each run) Mean number of hit counts in one PMT is ~5500 (corresponds to ~55 kHz) Expected number of hits from SN in 100ms is 11.6 ( 550 0) Bioluminescence bursts should be excluded Bioluminescence cut We have collected distributions of hit counts for each ...

Еще в разделе: (Показать все результаты (>21) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/docs/acceptance_bamberg2011-1.pdf

cAMP-induced conformational changes of Protein Kinase A I A-domain O. N. Rogacheva, V. E. Stefanov St. Petersburg State University, Universitetskaya nab. ... In the end, we presented the conformational transition of the A-domain in the form of a partly deterministic sequence of six events: 1) B 2) C1, D1, 3) E, 4) C2[D2], F, 5) G. The sequence of the items of this scheme corresponds to the process of the conformational transition in time. ...

Еще в разделе: (Показать все результаты (>263) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/138.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/91.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/155.pdf

... 2000 December 15 . IC443's Neutron Star . ... Explanation: Using x-ray data from the orbiting Chandra Observatory along with radio data from the Very Large Array , a team of researchers has discovered evidence for a new example of one of the most bizarre objects known to modern astrophysics -- a neutron star . ... The core collapsed when the star, located a reassuring 5,000 light-years away in the constellation Gemini , exploded long ago. How long ago? ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: August 28, 1998 - Hydrogen Trifid
• APOD: 2000 June 21 - Solstice Celebration
• APOD: 2000 January 11 - The Rosette Nebula in Hydrogen, Oxygen, and Sulfur

... Phys. A25 (2010) 3933 (arXiv:0908.0457 [hep-ph]) A brief reminder AdS/CFT correspondence ­ the conjectured equivalence between a string theory defined on one space and a CFT without gravity defined on conformal boundary of this space. ... At one imposes certain gauge invariant boundary conditions on the fields. Equation of motion for the scalar field Solution independent of usual 4 space-time coordinates where M is identified with the quark mass matrix and with the condensate. ...

Еще в разделе: (Показать все результаты (>174) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2011/Libanov_Neutrino.pdf
• http://qfthep.sinp.msu.ru/talks/rep_M_QFTHEP.pdf
• http://qfthep.sinp.msu.ru/talks2011/smolyakov_qfthep2011.pdf

Ambiguity of nepheline syenite family rock names and how to cope with this problem . ... There are no natural borders between chemical as well as mineral compositions of “different” rocks. ... It is possible to add to the term «nepheline syenite» the rank formula of mineral composition, reduced to three (or four) positions, receiving the rock name e.g. «nepheline syenite OrtAbNe». ... Reduced rank formulas of mineral composition (Rmin) for different representatives of nepheline syenite family . ...

Еще в разделе: (Показать все результаты (>480) - geo.web.ru/ )

• Trusov Sergey's homepage The influence of boundary layer effects on the melt
• The influence of boundary layer effects on the melt inclusions compositions.
• Принципы представления информации в Интернете в области наук о Земле

... They in fact form surfaces that can be treated as interfaces between polar aqueous solutions and non-polar environment of phospholipidic side chains. ... That's why our idea was to study the behaviour of amino acid residues, as monomer units of proteins, in an interfacial system. Objective By means of molecular dynamics simulations we intended to study the properties of amino acid residues in a system containing liquid-liquid interface between water and hexane, which we took as a non-polar phase. ...

Еще в разделе: (Показать все результаты (>269) - polly.phys.msu.ru/ )

• Science
• Laboratory of Broadband Dielectric Spectroscopy - Chair of Polymer and Crystal
• HEXAGONAL TUNGSTEN BRONZE AND PY

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Contact person: Dmitriy S. Vatolin (dmitriy@graphics.cs.msu.ru) . MSU Graphics & Media Lab (Video Group) . The filter is intended to remove subtitles, logos and other static opaque objects from video. ... Motion compensation for correct background reconstruction after logo removal. ... after the filter . ... Example in AVI (DivX4) video and comparison with LogoAway & X-Logo filters (1.5 MB) . ...

Еще в разделе: (Показать все результаты (>211) - graphics.cs.msu.ru/ )

• Automatic Binary Segmentation of Moving Objects in Video | Graphics and Media
• Automatic fixing of shifted fields in video | Лаборатория компьютерной графики
• Automatic fixing of shifted fields in video | Graphics and Media Lab

COMPARISON OF CLUSTERING ALGORITHMS FOR SPEAKER IDENTIFICATION Nikolay Lubimov, Evgeny Mikheev, Alexey Lukin Moscow Lomonosov State University, Moscow, Russia In this paper we consider the problem of text-independent speaker identification that refers to acoustic recognition research. ... We have performed the comparison of different clustering methods for speaker identification: the standard K-means clustering, K-means++, Linde-Buzo-Gray, Fuzzy C-means, and Gustafson-Kessel algorithms. ...

Еще в разделе: (Показать все результаты (>126) - imaging.cmc.msu.ru/ )

• Ringing analysis | Laboratory of Mathematical Methods of Image Processing
• Ringing effect modeling | Laboratory of Mathematical Methods of Image...

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>12) - lcl.srcc.msu.ru/ )

The Converter of Measurement Units is aimed to converting of measurement units between different systems of measurement, for example from British-American units of measurement to metric system and vice versa. To convert a value . ... On the left panel list select a measure you want to convert . ... Select the measurement unit you want to convert from . ... Select the measurement unit you want to convert to . ... Result is displayed in the "Conversion Result" area. ...

Еще в разделе: (Показать все результаты (>12) - sbmg.geol.msu.ru/ )

... CENTRE FOR PHOTONUCLEAR EXPERIMENTS DATA . Online Services | Partners | ... Contacts | ... CDFE: Online Services . Inverse Geometry gives to one the possibility to obtain the data for different reactions with the same combination of incident particle and target nucleus, for example . ... in one request and for energy recalculated from LAB-system to SCI-system . ... If you have any questions, comments, and/or suggestions, please, contact . CDFE Head : Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>4376) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• Wave function of helium-like ions

. Some individual experimental Cerenkov light LDF fits. Experimental pulse example. Differential energy spectrum. Tunka-25 energy spectrum among some other experimental data. Mean depth of EAS maximum with two different methods. EAS maximum depth distributions for two energies. Open histograms - experiment. Filled histograms - simulation for QGSJET-01 and complex composition.

Еще в разделе: (Показать все результаты (>26) - dbserv.sinp.msu.ru/ )

• 3d Map Description
• 1d Map Description

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )