... Moscow, Russia . ... March-October 2000 . ... Gusev A.S. Multicolor CCD Photometry of Six Lenticular and Spiral Galaxies. ... Gusev A.S., Park M.-G. Structure and stellar population of ringed barred galaxy NGC 2336 // Astronomy and Astrophysics, 2003, V.410, P.117-129. ... Gusev A.S. Photometric Properties of Bars in Galaxies // Astronomy Reports, 2000, V.44, N9, P.579-591. ... Gusev A.S. BVRI CCD Photometry of Pecular Galaxies NGC 5605 and NGC 5665 // Astronomy Reports, 2000, V.44, N9, P.569-578. ...

Еще в разделе: (Показать все результаты (>549) - lnfm1.sai.msu.ru/ )

• Fulbright scholar Leonid Zotov
• jg0027
• jg0035

THE CHEMICAL COMPOSITION OF REGOLITH AT THE MOON'S SOUTH POLE, ACCORDING TO DATA OF LUNAR PROSPECTOR AND LUNAR RECONNAISSANCE ORBITER MISSIONS. ... Introduction: The article tells about the results of integrated study of the craters at the Moon's South Pole with permanently shadowed region of craters. ... We have compared the ultimate composition of the soil matters in the craters with "cold traps" in the Moon's South Pole with regard to thorium, ferric oxide and hydrogen contents (Fig. ...

Еще в разделе: (Показать все результаты (>106) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Pug/Publications/m44_70_pugacheva.pdf
• Aleksei A. Berezhnoi
• Vladimir V. Busarev

... Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . Program . The program of the conference comprises plenary talks (50 min), section talks (45 min and 20 min) and poster presentations. ... Patrial Differential Equations . ... Special session "Control and Optimization in Partial Differential Equations" . ... Combinatorial and Toric Topology . ...

Еще в разделе: (Показать все результаты (>49) - pont2008.cmc.msu.ru/ )

• International Conference Differential Equations and Topology dedicated to the
• Video Records of Presentations International Conference Differential Equations
• Registration International Conference Differential Equations and Topology

... When receiving an article, nntpd has to deliver it to the news subsystem. ... To be able to properly perform the ihave/sendme protocol, nntpd has to be able to access the history file. ... You should also make sure that C-news and nntpd agree on the format of your history file. C-news uses dbm hashing functions to access it; however, there are quite a number of different and slightly incompatible implementations of the dbm library. ...

Еще в разделе: (Показать все результаты (>287) - itpm.msu.su/ )

• Article Batching

... Simulation of a molecular structure formation as a result of thermal disruption in amorphous carbon" . ... The IBM BlueGene/P supercomputer installed at the Faculty of Computational Mathematics and Cybernetics of the Lomonosov Moscow State University was used. Keywords: multiscale quantum molecular dynamics codes, phase transition in amorphous carbon, phase change memory, nanotechnology, supercomputer IBM BlueGene/P. PDF (Full text in Russian, References in English) (1.58MB) . ...

Еще в разделе: (Показать все результаты (>450) - num-meth.srcc.msu.ru/ )

• "Automated debugging of parallel programs"
• "Conditions of sourcewise representation and rates of convergence of methods
• Methods and concepts of vortex flow visualization in the problems of

... It was linked to the workshop of GEC (Quaternary Research Group of South America) devoted to the results of the INQUA project "Quaternary and Present Climates of the Paran and Uruguay Basins, SE South America" led by M.Iriondo. 16 participants from Argentina, Chile, Brazil and Mexico presented their results orally during 2 session days. ... After the welcome of the CRILAR director Dr. D. Gorla 8 talks on various aspects of South America Quaternary geology, paleogeography and geomorphology were given...

Еще в разделе: (Показать все результаты (>246) - www.fadr.msu.ru/ )

• Untitled
• REPORT ON V INTERNATIONAL SYMPOSIUM AND FIELD WORKSHOP ON PALEOPEDOLOGY
• the paleopedology working group had a conference last year in Mexico on "Global

... Liyong Liu (NAOC) . Site testing on seeing conditions of the astronomical observatories over China are briefly reviewed, including Xionglong station of NAOC, Gaomeigu station of Yunnan Observatory, Delingha station of Purple Mountain Observatory. ... PDF [3.0€аMB] October 8, 09:55 10:20 . ... In this paper, we will review the site survey activities in the past years, and present the site-testing results on the Oma site, including cloud cover, seeing, water vapor, transparency and sky brightness. ...

Еще в разделе: (Показать все результаты (>28) - site2010.sai.msu.ru/ )

• General information
• Media files
• Results of ELT site testing programs - I

Описание вакансии: . Vacancy: R Scientist, PhD (m/f) . ... Demonstrate and maintain expert knowledge in this scientific field. Act as a subject matter expert and technical resource for the organization, in close cooperation with teams all over the world (mainly in USA). ... PhD in catalysis-related chemistry field (Organic Chemistry, Organometallic Chemistry, Inorganic Chemistry, or Chemical Engineering). ... список всех вакансий . добавить вакансию . редактировать эту вакансию . ...

Еще в разделе: (Показать все результаты (>53) - www.chemport.ru/ )

• "R scientist/expert in catalysis-related chemistry, phd (m/f)" - вакансия в
• "Химик в корею" - вакансия в разделе "Работа для химиков" @ChemPort.Ru

International Laser Center of MSU . ... Lecture courses . ... SPIE student chapter . ... 3-d International Laser Graduate School "Modern Problems of Laser Physics LGS-2009 " . Moscow Vyatichi, November 9 - 11, 2009. ... Home Education Laser Graduate School . The International Laser Center of Moscow University is the organizer of annual sessions of the Laser Graduate School. ... For students of Moscow University, these short courses is a part of their regular lecture courses. ...

Еще в разделе: (Показать все результаты (>834) - ilc.phys.msu.ru/ )

• Conference
• Grant detail
• The CLEOR/Europe-EQEC 2005 Conference will take place from 12 to 17 June 2005

... The ability to image specific molecular biomarkers in vivo would have important implications for the earliest detection of various diseases, in assessing specific targeted therapies and for monitoring dynamic changes in expression patterns during disease progression. ... Non-invasive assessment of EGFR (170 kD epidermal growth factor receptor) overexpression in cancer is essential in understanding the implication of this receptor in cancer progression and the expression of aggressive phenotype. ...

Еще в разделе: (Показать все результаты (>112) - www.msm.biophys.msu.ru/ )

... Results . Aligned_sequences: 2 # 1: SYYM_HUMAN # 2: SYY_METJA # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 341 # Identity: 73/341 (21.4%) # Similarity: 125/341 (36.7%) # Gaps: 107/341 (31.4%) # Score: 154.0 # # #======================================= SYYM_HUMAN 1 -QTIYCGFDPTADSLHVGHLLALLGLFHLQRAGHNVIALVGGATARLGDP 49 ::.| ... SYY_METJA 50 G---------ELDEIRKIGDYNKKVFEAMGLKAKYVY------GSEFQLD 84 SYYM_HUMAN 100 NSAWYQKQHLVDFLAAVGGHFRMG--TLL--SRQSVQLRLKSPEGMSLAE 145 . ...

Еще в разделе: (Показать все результаты (>9518) - kodomo.fbb.msu.ru/ )

• allpy: 96e3c356d898 allpy/dna.py
• allpy: allpy/dna.py annotate
• allpy: 96e3c356d898 allpy/markups.py

... The Russian Federation Presidential Commission on the modernization and technological development of Russian economy Project "Formation of Highly Qualified Supercomputing Technology and Dedicated Software specialist training system" is now complete. ... Lomonosov Moscow State University, . ... The nationwide system of Research and Education Centers for Supercomputing Technologies (REC SCT), incorporating all Russian Federal Districts, formed the basis for the successful implementation of the project...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• HOPSA - the joint RF/EU project: HOlistic Performance System Analysis | Moscow
• Nationwide Supercomputing Education Project | Moscow University Supercomputing
• Russian Supercomputing Days: Together to be Stronger | Moscow University

... In one the conformational study of viral RNAs was performed. ... Movement protein (MP) molecules were found to be distributed along the chain of RNA and the structure of MP–RNA complexes depended on the molar MP:RNA ratios at which the complexes were formed. ... The study of bacterial cell was done in the second project [1,5,6]. ... The functionalization of tips was monitored by fluorescent microscopy and the force measurements with AFM. ... The kinetics of DNA adsorption to APS-mica was studied. ...

Еще в разделе: (Показать все результаты (>128) - www.spm.genebee.msu.ru/ )

• Alexander S. Filonov Professional Publications
• Image formation and processing methods
• FemtoScan Online program

... Gusakov A. , Sinitsyn A. , Grishutin S. , Tikhomirov D., Shook D. , Scheer D., Emalfarb M. в журнале TEXTILE CHEMIST AND COLORIST & AMERICAN DYESTUFF REPORTER , том 32, ? ...

Еще в разделе: (Показать все результаты (>7636) - istina.msu.ru/ )

• Legendre B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Journal of Physics: Conference Series - журнал | ИСТИНА - Интеллектуальная
• Scientific reports - журнал | ИСТИНА - Интеллектуальная Система Тематического

... Working technology became a part of instruction for geophysical work in this region, prepared in the institute UkrVNIMI. ... The winter researches on the site Volodarskoje (Moscow region), polluted by a thick layer (up to 3 m) of chicken dropping . ... The field studies at Moscow oil refining factory in Kapotnja. ... Geophysical studies around oil refining factories in Samara region with a purpose of estimattion of oil pollution and search for hydrocarbons' secondary deposits . ...

Еще в разделе: (Показать все результаты (>77) - geophys.geol.msu.ru/ )

• Page 3. Publications
• Near-surface electrical prospecting laboratory at Moscow University

... Faculty . ... 119991, Moscow, GSP-1, Leninskiye Gory, MSU, 2nd Educational Building, CMC Faculty, rooms 734, 784 (Head of the department) . ... The remarkable technological achievements and their strong impact on the international communication environment in the 21st century have made the English language proficiency especially essential for the graduates of Computational Mathematics and Cybernetics faculty. ... Foreign language teaching is a compulsory component of a modern professional training. ...

Еще в разделе: (Показать все результаты (>260) - en.cs.msu.ru/ )

• CMC MSU students at GSIS Summer School, Tohoku University, Japan | CMC MSU
• Department of English
• Laboratory of Mathematical Physics | CMC MSU

RESOLUTION of the Research and Practice Conference "Modern approaches to the formation of legal basis of education" October 5, 2010. The participants of the Research and Practice Conference formation of legal basis of education", representing Russian institutions, research and development organisations, business legislative authorities of the Russian Federation, public orga missions held an open expert discussion of the draft federal Russian Federation". ... The principle of academic freedom. ...

Еще в разделе: (Показать все результаты (>152) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/173.doc
• http://www.rsr-online.ru/doc/2010_10_07/24.pdf
• http://www.rsr-online.ru/doc/!2013/09/01/1.pdf

... School of Public Administration . Lomonosov Moscow State University . ... Moderator: Prof. V.A.Nikonov, Dean, School of Public Administration, Lomonosov Moscow State University . ... Chairperson: Prof. A.I. Solovyov, School of Public Administration, Lomonosov Moscow State University . ... Chairperson: Prof. A.V. Surin, School of Public Administration, Lomonosov Moscow State University . ... Chairperson: Prof. V.G. Koshkidko, School of Public Administration, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>1051) - www.spa.msu.ru/ )

• Manuscript guidelines
• The 14th International Conference 'Public Administration of the Russian

... Comparison of soluble and placental transferrin receptors as standards for the determination of soluble transferrin receptor in humans. ... 1500 kDa, whereas the MW of sTfR corresponded to 237 kDa. ... The serum sTfR levels calculated against sTfR were 2.5 times lower than those calculated against pTfR. Serum sTfR levels are overestimated when pTfR is used as the standard. ...

Еще в разделе: (Показать все результаты (>262) - biochem.bio.msu.ru/ )

• Disruption of Amyloid Prion Protein Aggregates by Cationic Pyridylphenylene
• Submitochondrial fragments of brain mitochondria: general characteristics and
• Biochemistry Department of Moscow State University | Na,K-ATPase and its role

... President George W. Bush Department of Education Strategic Goals: Goal One: Create a Culture of Achievement Create a culture of achievement by effectively implementing the president's plan, No Child Left Behind, and by basing all federal education programs on its principles: accountability, flexibility, expanded parental options, and doing what works. ... Goal Six: Establish Management Excellence Create a culture of accountability throughout the Department of Education. ... accountability | ... line...

Еще в разделе: (Показать все результаты (>2) - www.edst.msu.ru/ )