... Second-year students classes . Introduction to Linux . ... 32-bit Microcontroller Programming . ... In the given practical special course we address user techniques for working with Linux OS; we study the interface of the command line in great detail, methods of automation and batch processing, composition of scientific articles as well as the specifics of software design by using in-built toolkit. ... Use of console interface of the command line, automation (bash scripts) . ...

Еще в разделе: (Показать все результаты (>21) - engineering.phys.msu.ru/ )

• Parallel Programming
• Circuit Diagnostics
• FPGA Design

Fortran-DVM . ... Language description . ... 2.2 Syntax of FDVM directives . ... 4.2 Distribution of dynamic arrays . ... 6 Remote data specification . ... 6.2 SHADOW type references . ... 6.2.2 Synchronous specification of independent references of SHADOW type for single loop . ... 6.2.5 Asynchronous specification of independent references of SHADOW type . ... 6.3.3 Asynchronous specification of REMOTE type references . ... 6.4.2 Asynchronous specification of REDUCTION type references . ...

Еще в разделе: (Показать все результаты (>126) - sp.cs.msu.ru/ )

• C-DVM language description
• DVM - publications
• Lib-DVM library. Detailed design. Part 3 (12.16-12.18)

... Sternberg Astronomical Institute , Moscow University . ... Present edition unites two parts of Catalogue of interacting galaxies by B.A.Vorontsov-Velyaminov: the first part (Part 1) containing 355 systems was published in 1959 [1] and the second one (Part 2) with 497 objects - in 1976 [2].Thus two published parts of Catalogue include 852 interacting systems. ... All new of them (1162 by number) were taken from the comments to the galaxies in Morphological catalogue by Vorontsov-Velyaminov et al.[ ...

Еще в разделе: (Показать все результаты (>18) - www.sai.msu.ru/ )

• Uploading Files

Participants of the project . Scientific information . ... Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University ? chief developer and executor. Physics-Technical Faculty of Ulyanovsk State University. Kostroma State University. ... Contains information about space weather based on the data from GOES, ACE satellites. The project of a supersmall satellite "Baumanets" , developed by the students of Bauman Moscow State Technical University. ...

Еще в разделе: (Показать все результаты (>54) - cosmos.msu.ru/ )

... HUMLANG . ANNOUNCEMENTS . 20.12.2002 Book announcement . ... Reference Direct and Anaphoric . Alan Berger . In this book Alan Berger further develops the new theory of reference--as formulated by Kripke and Putnam--applying it in novel ways to many philosophical problems concerning reference and existence. ... The book is organized in three parts. ... Electronic Dictionary . New electronic dictionary "Religious Lexicon in Russian Poetry of Silver Age" (A-G) (add by V.P.Grigoriev) . ...

Еще в разделе: (Показать все результаты (>43) - old.philol.msu.ru/ )

• MSU-LGCLL:: Krylov J.K. - On the Nature of Koehler's Effect
• HumLang - Объявления - Архив
• Human Language - Язык Человека

Contents. planet: 5 - Jupiter satellites: J6-Himalia : 1, J7-Elara : 8, J8-Pasiphae: 5 total number: 14 type: absolute dates: 1997-1999 observatory: 673 - Table Mountain Observatory, Wrightwood Reference. ... These are reduced positions from CCD observations of three of the outer Jovian satellites, taken on three nights in the past three years. ... Year of the moment of observation 3. ... Hour of right ascension (alpha, h) 6. ... Degree of declination (delta, deg) 9. ...

Еще в разделе: (Показать все результаты (>305) - lnfm1.sai.msu.ru/ )

• jg0020
• jg0021
• jg0037

... Manuscripts submitted to the journal should be divided into the following sections: Title page, Abstract (in Russian and English), Key words (in Russian and English), main manuscript text, list of references, tables, figures and figure captions. ... Full size of the article includes list of references, tables and figures. ... Rich text format (*.rtf) . ... References are given in the text in square brackets; full references are given at the end of the manuscript in the section List of references. ...

Еще в разделе: (Показать все результаты (>25) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/zzx/11_2_en.doc

... Manuscripts are classified in size into the three categories: . ... The most stringent requirements are imposed on manuscripts of the first category. ... Manuscripts of the second category should contain a representation of main results without excessive details in conclusions and proofs. ... Manuscripts should be prepared in electronic form using LaTeX 2.09 (see the instructions for manuscript preparation in electronic form) . ... The manuscript should be signed by its author(s). ...

Еще в разделе: (Показать все результаты (>42) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Instructions
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 5/2014

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>6281) - kodomo.fbb.msu.ru/ )

• allpy: allpy/protein.py history
• UniProt fields
• allpy: log

Laboratory of engineering geophysics and shallow-depth electrical methods includes several scientific groups, headed by prof. A.A.Ogilvi and prof.V.A.Bogoslovsky, by prof.V.K.Khmelevskoy and by assoc. prof. I.N.Modin and V.A.Shevnin . ... Study of dynamics and pollution of underground water with the methods of borehole and aquatorial geophysics. ... A.A.Ogilvy, M.A.Ayed, V.A.Bogoslovsky. ... Application of geophysical methods for studying the technical status of earth dams. ...

Еще в разделе: (Показать все результаты (>61) - geophys.geol.msu.ru/ )

• TES. Conclusion
• Anis. Page 10
• TES tecnology. MSU.

. Set 1: List of species Reference tree . Set 2: List of species Reference tree . Set 3: List of species Reference tree . Set 4: List of species Reference tree . For the set 1 . For the sets 2 4

Еще в разделе: (Показать все результаты (>7) - mouse.genebee.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... On this page we collect references to our resources, documentation and resources on other sites. All these data are very helpful for everybody who wants to learn practical quantum chemistry. Firefly (PC GAMESS) main page . ... ERG group wrote some articles about visualization: . ... Нет комментариев " Quantum chemistry information page " . ... Quantum chemistry information page . ... 2015 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>25) - erg.biophys.msu.ru/ )

• Using RESP with GAMESS-US and Firefly (PC-GAMESS) ERG Research Group:
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической
• Phase plane explorer ERG Research Group: Лаборатория теоретической биофизики

... Moscow State University Russian Language Centre . Moscow State University . ... Learn Russian at the Moscow State University! ... 28.05.2004 . New full on-line Russian language reference on our website! (more.. ... On April, 29, 2004 the rector of the Moscow M.V.Lomonosov State University academician V.A.Sadovnichy signed the order on creation of the Moscow school of economy of the Moscow M.V.Lomonosov State University. (more.. ... Space tourist calls Russian language his greatest challenge . ...

Еще в разделе: (Показать все результаты (>2) - www.rlcentre.com/ )

... The RADEN data bank produced at the Department of Chemistry of Moscow State University is designed as well to accumulate published information on radiative parameters of diatomic molecules, as to analyse it and recommend the more reliable values. ... electronic transition moments D ( R ); . ... dipole moments, . ... FACTUAL RECOMMENDED DATABASE contains now the ab initio and experimental electronic transition moments for more than 250 band systems which belong to more than 100 diatomic molecules. ...

Еще в разделе: (Показать все результаты (>57) - electr003.chem.msu.ru/ )

• Theory as a Lighthouse in the Electrochemical Ocean

... Analysis of resonant excitation of layered and block media on the basis of discrete models" . Sadovskii V.M. and Chentsov E.P. Resonant processes in structurally inhomogeneous materials of layered and block microstructure are studied in the framework of discrete models. Natural frequencies of longitudinal motion in a linear monato\-mic chain modeling a layered medium are determined for various boundary conditions. ... This special resonant frequency does not depend on the chain length. ...

Еще в разделе: (Показать все результаты (>215) - num-meth.srcc.msu.ru/ )

• Flow simulation by the lattice Boltzmann method with multiple-relaxation times
• "Asymptotic behavior of a solution to the Brownian motion"
• Peer Review Process

Help www.sciencedirect.com www.sciencedirect.com R www.sciencedirect.com , ScienceDirect. , (licensed user). ... R PAGE 1 OF 9 www.sciencedirect.com Quick Search, Journals, Books, Reference Works and Abstract Databases Quick Search ( ), Journals (), Reference Works ( ), Books ( ) Abstract Databases ( ). Quick Search ( ) - , . ... ProCite, EndNote Reference Manager). 3a 3a R PAGE 8 OF 9 www.sciencedirect.com 1 Alerts ( ) , , : I Search Alerts ( ); I Journals Issue Alerts ( ); I Citation Alerts ( ). ...

Еще в разделе: (Показать все результаты (>15) - wwwlib.phys.msu.ru/ )

• http://wwwlib.phys.msu.ru/books/scopus_qrg_russian.pdf

Backlinks to DataForms in all Webs ( Search System Web only ) . ... Appendix C: CSS Listing of CSS class names emitted from Foswiki core code and standard extensions. ... NEW - 28 Aug 2011 - 11:49 by ProjectContributor . ... NEW - 03 Aug 2010 - 16:42 by ProjectContributor . ... Statistics for System Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads: ... r1088 - 22 Nov 2013 - 23:01 by AdminUser . Number of topics: 29 . ...

Еще в разделе: (Показать все результаты (>7017) - wiki.cs.msu.ru/ )

• (backlinks in System Web) DataForms < System < Foswiki
• (backlinks in System Web) CommandAndCGIScripts < System < Foswiki
• (backlinks in System Web) TemplateTopics < System < Foswiki

by Margarita Dzhalalova It is known that the pressure difference values for a round parachute are constant over total canopy, then for a square parachute the values of pressure difference are non-uniform along radial ribbons differing even from each other and depending mainly on certain sets of line lengths, and therefore square parachutes attain different shapes from each other ( Fig.1 - photo of var.1 and var.2). ... Distribution of pressure coefficient along radial ribbons of square parachute. ...

Еще в разделе: (Показать все результаты (>6) - margaret.imec.msu.ru/ )

... Science . ... lrm@cs.msu.su . ... The Laboratory of Difference Methods was founded by A.A.Samarsky, Academician of RAS, in the middle of the 60s. For more than 50 years the Laboratory?s theoretical research has been focused on numerical methods for problems described by systems of partial differential equations. ... N.V.Ardelyan, V.L.Bychkov, I.V.Kochetov and K.V.Kosmachevskii, Non-self-maintained discharge plasma in propane-air mixture // IEEE Trans. on Plasma Science, vol. 39. no. 12, part 1, pp. ...

Еще в разделе: (Показать все результаты (>191) - en.cs.msu.ru/ )

• Laboratory of Difference Methods
• About this site

... PbTe, SnTe, GeTe and their solid solutions are narrow-gap semiconductors widely used in infrared optoelectronics and for thermoelectric energy conversion. ... The present work is a continuation of recent EXAFS studies performed at the NSLS on GeTe, SnTe and PbTe crystals doped with high concentration of indium (10-35 at.% ... The studied samples were PbTe, SnTe and GeTe doped with 1.5-2% of indium along two sections (InTe and In 2 Te 3 ) of the phase diagrams. ... Results of data analysis. ...

Еще в разделе: (Показать все результаты (>49) - scon155.phys.msu.su/ )

• Influence of random fields on the ferroelectric phase transition in IV-VI
• Low-temperature phase transitions in some quaternary solid solutions of IV-VI