. Victor I. Mokeev. N* Studies in Meson Electroproductionwith CLAS V.I. Mokeev. The models for evaluation of ? v NN* electrocouplings from the N?, N?? electroproduction data and their extension for photon virtualities up to 12 GeV 2 .

Еще в разделе: (Показать все результаты (>115) - nuclphys.sinp.msu.ru/ )

• Ядерная физика в интернете
• Unveiling of the bust in memory of N.N.Bogolliubov at the Conference Hall of

Custom Ticket Fields = Trac supports adding custom, user-defined fields to the ticket module. ... The syntax of each field definition is: {{{ FIELD_NAME = TYPE (FIELD_NAME.OPTION = VALUE) .. ... Available Field Types and Options === * '''text''': A simple (one line) text field. * label: Descriptive label. * value: Default value. * order: Sort order placement. ... Updating the database === As noted above, any tickets created before a custom field has been defined will not have a value for that field. ...

Еще в разделе: (Показать все результаты (>1733) - kodomo.cmm.msu.ru/ )

• Help: templating
• WikiFormatting ? Tanchiki
• TracWorkflow тАУ Tanchiki

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>69) - monkey.belozersky.msu.ru/ )

• SDP home page
• About authors ot this complex
• SDPpred

... Seminar archive . ... Seminar archive 2012 14 September . ... The VLT Survey Telescope: a year after its coming into operation" . ... The VLT Survey Telescope (VST) is a 2.6 m wide field optical telescope located at the Cerro Paranal Observatory of ESO in the Chilean Andes. ... VST features an active optics system which guarantees an overall instrumental resolution of 0.5 arc-seconds over a field of view of 1 x1 , with only marginally elongated images. ... All seminars: . ...

Еще в разделе: (Показать все результаты (>22) - master.sai.msu.ru/ )

e-mail: dk89@mail.ru) , , , , John Foran, revolution, postmodern, globalization, political cultures of opposition "" . The article presents John Foran's experience of bulding a theory of postmodern revolution based on overcoming the discourses of "the end" of modern revolution theorie's components. ... It contains the experience of postmodern and modern revolution's components compare in the baise of concept of political culture of opposition. ...

Еще в разделе: (Показать все результаты (>17) - vestnik.socio.msu.ru/ )

... Academic Departments . ... Partners . ... All partners . ... 25.09.2013 On September 20, 2013 Professor Jens Wendland (Freies Russisch-Deutsches Insitut fur Publicistik-FRDIP) delivered a lecture within the frames of the Master degree course Current Issues in the Mass Media . ... The next meeting of the students following the course Current Issues in the Mass Media will be on September 27, 2013. ...

Еще в разделе: (Показать все результаты (>54) - www.journ.msu.ru/ )

• On September 08-12, 2014 the Faculty of Journalism, MSU welcomed Professor
• On September, 18 Dr. Katja Lehtisaari (University of Helsinke, Finland?) will
• News :: Department of Journalism, M. V. Lomonosov Moscow State University <span

... Academic Programmes . ... NEW Dates Price . ... 4 weeks minimum . ... TUITION FEES . ... Full-Time Tuition - 2 6 academic hours per week : . ... Part-Time Tuition - 18 academic hours per week : . ... If paid in several installments, course fees are calculated at the rate of US $ 150 per week for full-time tuition and US $ 120 per week for part-time tuition. ... 1 Full-Time Tuition (24 academic hours per week) US $ 1 95 per week . ... Part-Time Tuition (20 academic hours per week) US $ 1 70 per week ...

Еще в разделе: (Показать все результаты (>20) - www.cie.ru/ )

• Study Periods :: Admissions :: CIE
• Tuition Fees :: Admissions :: CIE
• Frais de scolarit? :: Condition d??tudes :: CEI

. Advanced Study Institute "Structure and Dynamics of Elementary Matter", . Kemer, Turkey, September 21 - October 2, 2003 . To Hadronic Interactions Laboratory Home Page . To Igor Lokhtin Home Page . Last update: October 3, 2003, Igor Lokhtin

Еще в разделе: (Показать все результаты (>36) - lav01.sinp.msu.ru/ )

• Vacation in Russalka, Bulgaria, September 5-19, 2003
• Activity of Igor Lokhtin
• Photos related to Igor Lokhtin

. Solar eclipse of September 22, 1968. Lake Balhash, settlement of Sary-Shagan. Return . Department . of Lunar and . Planetary Research . Return on . Goryachev M.V.

Еще в разделе: (Показать все результаты (>77) - selena.sai.msu.ru/ )

• Congratulatory

Alexander S. Antonov . ... M.V.Lomonossov Moscow State University . ... June 4, 1999, Moscow State University . ... 1994-2000: programmer, Laboratory of Parallel Information Technologies, Research Computer Center, Moscow State University . ... A.S. Antonov, A.M. Teplov. ... Antonov A.S., Voevodin Vl.V., Sobolev S.I., Filamophitskiy M.P. Internet-Auditorium of Lomonosov Moscow State University // Abstracts of the All-Russian scientific conference "Scientific Services Internet" (Novorossiysk, 2000). ...

Еще в разделе: (Показать все результаты (>11) - asa.guru.ru/ )

... help . find changesets by author, revision, files, or words in the commit message Template Usage Mercurial allows you to customize output of commands through templates. ... Usage: $ hg log -r1 --style changelog A template is a piece of text, with markup to invoke variable expansion: $ hg log -r1 --template "{node}\n" b56ce7b07c52de7d5fd79fb89701ea538af65746 Strings in curly braces are called keywords. ... The changeset bisection status. bookmarks List of strings. ...

Еще в разделе: (Показать все результаты (>12483) - kodomo.fbb.msu.ru/ )

• allpy: 6ff63f233fb9 test/usecase3.py
• allpy: 6ff63f233fb9 test/usecase2.py
• allpy: a3ffdddb2a72 test/usecase2.py

... Electronic journal Issue 4. 10 september 2004 Ulrich M. Sustainable Management of Natural Resources Introduction. ... To learn about the dynamics of natural resource management and the tragedy of the commons by means of a direct experience in the simulation game «NEW COMMONS GAME». ... 2) Tragedy of the commons and management of natural resources. ... The simulation game was followed by a short debriefing on the dynamics of the tragedy of the commons and natural resource management. ...

Еще в разделе: (Показать все результаты (>8) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./bonham_surin.pdf

... 247th American Chemical Society National Meeting and Exposition "Chemistry and materials for energy" , March 16-20, Dallas, TX Talk: A.V. Nemukhin "QM/MM-based modeling of structure and spectra of fluorescent proteins" . ... IV International Symposium "Topical Problems of Biophotonics", July 21-27, Nizhny Novgorod Invited talk: M.G. Khrenova , A.V. Nemukhin, A.P. Savitsky "Molecular modeling of the Forster resonance energy transfer between fluorescent proteins" . ...

Еще в разделе: (Показать все результаты (>5) - lcc.chem.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

.

Еще в разделе: (Показать все результаты (>18) - www.chemport.ru/ )

• Real estate market monitoring september 2011 3 дрсу база данных землевладельцев

... GeneBee . ... Courses in Bioinformatics . ... What is GCG? ... Usage of GCG Package on GeneBee Server . ... What is WhatIf? ... Computer Class . ... Due to colaborate work of many laboratories the total length of published nucleotide sequences is now . ... GCG vs. ... Usage of GCG Package on GeneBee server . ... Computer class . ... Computer class is used for bioinformatic courses and for scientific semenars. ... Everyone who need a consultation for GeneBee service, GCG or WhatIf package is welcomed...

Еще в разделе: (Показать все результаты (>168) - www.genebee.msu.ru/ )

• Biochemistry (Moscow), Vol
• GeneBee BLAST 2.2.22+ Services Help
• FASTA format description

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>63) - geophys.geol.msu.ru/ )

• TES. Field example.
• Page 3. Publications
• TES tecnology. MSU.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

... Seismo-tectonics of Tsunami . Numerical and Analytical Models of Local Tsunami Behavior . ... During Field Trips, participants will be acquainted with tsunami manifestation sites on the Pacific coast of Kamchatka and the most interesting geological sections showing key marker tephra layers and a tsunami deposits from prehistorical and historical events (including tsunami 1952 Kamchatka tsunami deposits). ... Helicopter trips are strongly depended on the very changeable Kamchatka weather. ...

Еще в разделе: (Показать все результаты (>27) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION

V Russian-Dutch Workshop "Work Incentives in Russian Industry, 1861-2000: Compensation, Commitment and Coercion" Moscow, September 13-14, 2002 Conference Room (652), Faculty of History, Moscow Lomonosov State University Programme of the Workshop Friday, September 13 Opening session. ... Evolution of Work Incentives in the Russian Metalworking Industry: Case Studies Chair: Andrey Sokolov 14:30-15:15. Andrey Markevich (Institute of Russian History of the Russian Academy of Sciences IRH RAS). ...

Еще в разделе: (Показать все результаты (>3254) - hist.msu.ru/ )

• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples
• "Novaya i noveishaia istoria" Journal
• The petroleum sector of Norway. Periods of development and state adjustment.