Open Conference Systems . Conference Help . ... Conference Content Search . ... Conference Information . ... By Conference . ... Home > ICONO/LAT 2016 > Intl. Conf. on Coherent and Nonlinear Optics/Intl. Conf. on Lasers, Applications, and Technologies . The leading event in the area of quantum electronics, laser physics, photonics and their applications. ... ICONO/LAT 2016 will be held in Minsk, the capital and largest city in Belarus, The oldest mentions of Minsk date back to 1067. ...

Еще в разделе: (Показать все результаты (>20) - hea.phys.msu.su/ )

• Search
• ICONO/LAT 2016

... 1982 |113587, Russia, Moscow | ... Education |September, |Student of Physics Faculty of Moscow State University,| |2003-present |chair "Polymers and crystals", working on Master's | ... References Dr. A.Yu.Loskutov, Physics Department MSU, Professor, Vorobevi Gori, Physics Department room 3-24, Moscow, Russia,tel: +7095(939)-51-56, e- mail:loskutov@chaos.phys.msu.ru Dr.V.V.dean of Physics Department, Physics Department MSU, Professor, Vorobevi Gori, Physics Department 119992, Moscow, Russia. ...

Еще в разделе: (Показать все результаты (>123) - polly.phys.msu.ru/ )

• http://poly.phys.msu.ru/en/news/attach/2013-05-07-PCAM-program.doc
• Inna Malyshkina's home page - Curriculum Vitae
• Biography

... About lab . ... MSU Graphics & Media Lab (Video Group) . Algorithm allows to double frame rate (fps) of the video stream. ... D.Vatolin, S.Grishin, "Video Frame Rate Conversion Method Based on Compensated Frames Interpolation", "New Information Technologies in Automated Systems" Seminar at M.V.Keldysh Institute of Applied Mathematics (2006). ... D.Vatolin, S.Grishin, "Double Up-conversion of Video Frame Rate Based on Two-Dimensional Motion Compensation", "Programming" Magazine (2006). ...

Еще в разделе: (Показать все результаты (>193) - graphics.cs.msu.ru/ )

• Video Frame Rate Double Up-Conversion | Лаборатория компьютерной графики и
• Image colorization | Graphics and Media Lab
• Image colorization | Лаборатория компьютерной графики и мультимедиа

Wanted to Know about Log Periodic Power Laws for Bubble Modelling but Were Afraid to Ask (with P. Geraskin) (in) NONLINEAR FINANCIAL ECONOMETRICS: Mark ov Swit ching Models , Persist ence and Nonlinear Coint egrat ion, Palgrave Macmillan, p. 104- 123, (2011) Fractionally Integrated Models for Volatilit y: A Review (in) FINANCIAL ECONOMETRICS MODELING: Mark et Microst ruct ure, Fact or Models and Financial ...

Еще в разделе: (Показать все результаты (>17) - www.mse-msu.ru/ )

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>6953) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... License . ... This program is free software: you can redistribute it and/or modify . it under the terms of the GNU General Public License as published by . the Free Software Foundation, either version 3 of the License, or . ... This program is distributed in the hope that it will be useful, . ... GNU General Public License GNU General Public License for more details. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... Sergei A. Astafief Ph.D., associate professor, Economics, Investment Management and Real Estate Management Department, Baikal State University of Economics and Law. ... Various participants of the market, try to solve the problems of construction of a rating of subjects of market economy. One of the responsibilities of Federal Service of Statistics is creating a rating of the enterprises on the basis of the statistical information received from them. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>124) - ee-journal.spa.msu.ru/ )

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>2) - oc.cs.msu.ru/ )

... Contact information . ... 119991, Moscow, GSP-1, Leninskiye Gory, MSU, 2nd Educational Building, CMC Faculty . ... Our goal is to provide researchers from many branches of science, education and industry with innovative tools and methods for solving applied problems using the latest information technologies, modern methods of computation modeling and scientific visualization. ... The uncertainty can be used in further uncertainty estimation of a computational model that uses FetchClimate. ...

Еще в разделе: (Показать все результаты (>224) - en.cs.msu.ru/ )

• Laboratory of Programming Technologies | CMC MSU
• Laboratory of Industrial Mathematics | CMC MSU
• Regulatory information | CMC MSU

... On behalf of the hosting geochemical community from the Institute of Volcanology and Seismology and Russian Academy of Sciences (RAS) we are happy to invite the international geochemical scientific group working on volcanic gases to participate in the 2011 Gas Workshop to be held in Kamchatka, Russia, between 1 st and 10 th September 2011. ... Measurements of soil degassing at Mutnovsky geothermal field 11th Gas Workshop, Kamchatka, Russia CCVG-IAVCEI . ... IAVCEI Organizing Committee . ... IAVCEI ....

Еще в разделе: (Показать все результаты (>398) - geo.web.ru/ )

• Eldfell, Heimaey, Iceland
• Гидрогеология горных пород. - Все о Геологии (geo.web.ru)
• Trusov Sergey's homepage Curriculum Vitae of Trusov Sergey Viktorovich

install ]] . ... Installation of a user directory . ... Below, we use the following notations: XXXX - CompHEP version number; comphep-XXXX - directory where CompHEP files will live; comphep-XXXX.tgz - distributive tar-file with sources; comphep-XXXX-linux.tgz - distributive tar-file with binaries; . ... The directory with name comphep-XXXX will be created with all files of CompHEP distributive. ... In order to create a user working directory execute: make setup WDIR=path_to_user_work_directory . ...

Еще в разделе: (Показать все результаты (>18) - comphep.sinp.msu.ru/ )

... Институт . ... Студентам . Приветствуем вас на Официальном сайте Русско-германского института науки и культуры. Published by admin on April 6, 2016 under Новости . ... No Comments ? ... 09.00 - 15.30 љ љљ 736 - 1.ГУМ . ... Морозова Е.Б. пн. љ17-00? 18-30, 18-45?20-15, 20-30?21-15љ 1 к., ауд.736 1 ГУМ . ... Башкиров В. М. вторник 15.00-17.00, четверг љ15.00-17.00, 1 ГУМ ауд.736 . вторник 17.00-19.00, пятница 17.00-19.00 1 ГУМ ауд.736 . ... 736 1 Гум) . ... 7361 Гум) . ... December 2011 . ...

Еще в разделе: (Показать все результаты (>2) - rgi.msu.ru/ )

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPlight
• User's guide

CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...

Еще в разделе: (Показать все результаты (>16) - astrometric.sai.msu.ru/ )

• Photos. Before 2003

Quantum uncertainty not all in the measurement . A common interpretation of Heisenberg's uncertainty principle is proven false. ... The uncertainty principle limits what we can know about a quantum . ... A new experiment shows that . ... fundamental limit to what one can know about a quantum system. ... Heisenberg's principle, there is a limit to the certainty with which . ... that measurement of one polarization did not always disturb the other . ... predicted by the uncertainty principle. ...

Еще в разделе: (Показать все результаты (>359) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/koehler_understanding.pdf
• http://temporology.bio.msu.ru/EREPORTS/levich_search_for_sources.htm
• Russian Interdisciplinary Temporology Seminar

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Web Sites . ... General Information . ... Most programs at the Moscow State University are taught in Russian. ... passing Russian State Exam (ЕГЭ), following the general rules on http://cpk.msu.ru ), . ... Lomonosov Moscow State University Institute of Russian Language and Culture . ... Lomonosov Moscow State University . ... Copyright 1997?2016 Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>66) - www.msu.ru/ )

• Alexander Vladimirovich SIDOROVICH - Pro-Rector

. Sponsored by: . The Russian Foundation for Fundamental Researches, . Snecma Moteurs (Groupe Snecma, France) . NPO SATURN Inc. Lyulka Technical and Scientific Centre . The Colloquium-458, organized by EUROMECH , will take place at Institute of Mechanics of Lomonosov Moscow State University (MSU) . This colloquium will be held in the frame of 250th anniversary celebration of MSU. Please, see first announcement and second announcement.

Еще в разделе: (Показать все результаты (>3) - www.imec.msu.ru/ )

• "Advanced Methods in Validation and Identification of Nonlinear Constitutive
• EUROMECH Colloquium-458

... Course "Computer Physics" for 1st and 2nd year students of Physics . ... The audience is 1st and 2nd year students of Physics. ... It consists of a short lecture course, seminars, and a large number of computer labs. ... 1985-1994 : Lectured a specialized course on "Computer Physics"for the 3rd year students of Physics, Department of Physics, and attendees of the continuing education department, International Laser Center of Moscow State University. ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>72) - qilab.phys.msu.ru/ )

... September, 2005 . ... Moscow State University Russian Language Centre . ... Learn Russian at the Moscow State University! New academic year at MGU . ... You will not only learn Russian for your professional career, but also learn a lot about Russia and its people that will allow you to communicate with your Russian clients more efficiently. www.rlcentre.com . ... Russia's first 24-hour English-language news channel, Russia Today, launched its trial broadcast in September. (more.. ...

Еще в разделе: (Показать все результаты (>12) - www.rlcentre.com/ )

... Algebraic Topology Conference . ... 9-13 September 2002 . ... New Contexts for Stable Homotopy Theory . ... 2 September - 20 December 2002 . 30 April 2002 . ... Geometric Topology II New! ... 21 - 28 April 2003 . 5-th Conference on " Geometry and Topology of Manifolds " . ... 27 April - 3 May 2003 . International conference " Kolmogorov and Contemporary Mathematics " in commemoration of the Centennial of Andrei Nikolaevich Kolmogorov New! ... Topology ATLAS: Conferences and Seminars . ...

Еще в разделе: (Показать все результаты (>140) - higeom.math.msu.su/ )

• INVITED ADDRESSES:
• Old conferences (English)