M.H. Shulman, 2006 Michael H. Shulman ON AN IMPORTANT COSMOLOGICAL PROBLEMS SOLUTION IN THE FRAME OF A NEW COSMOLOGICAL MODEL Abstract A modification of the Einstein ­ Friedmann cosmological model allows to solve a basic cosmological fundamental and observational problems, such as these ones: the vacuum energy and dark energy problems, horizon problem, flatness problem, supernovae low brightness at the high redshift (z > 1). ... New cosmological model The upper curve on the figure 2 is linear. ...

Еще в разделе: (Показать все результаты (>306) - chronos.msu.ru/ )

• Купервассер О.Ю. (O. Kupervasser )

... Submitted by Маруся_П on Wed, 03/09/2016 - 16:07 . The paperљ Optical tweezers study of red blood cell aggregation andљdisaggregationљin plasma and protein solutions љwritten by Maria D.љKhokhlova,љEvgenyљV.љLyubin,љAndreyљA.љFedyaninљin collaboration withљKisungљLee,љMattiљKinnunen, Alexander V.љPriezzhevљand IgorљMeglinskiљ has just been published online љinљ The Journal of Biomedical Optics . ... Maxim Shcherbakov presents the nanophotonics on the Set Up Lectorium: . ...

Еще в разделе: (Показать все результаты (>101) - nanolab.phys.msu.ru/ )

• Our paper has been published in The Journal of Biomedical Optics | Laboratory
• Evgeny V. Lyubin | Laboratory of Nanophotonics & Metamaterials

... Main . ... Journals . Conferences . Contacts . ... Sixth International Conference "Geometry, Dynamics, Integrable Systems ? GDIS 2016" (2 - 5 June 2016) . International Conference "Metric structures and control systems" (17 - 21 December 2015) . ... International Scientific Conference "Nonlinear methods in Physics and Mechanics" (1 - 3 October 2015) . ... Institute of Computer Science Izhevsk, 2005 - 2016 . ...

Еще в разделе: (Показать все результаты (>99) - ics.org.ru/ )

• Institute of Computer Sciences - Conferences - International Scientific
• Institute of Computer Sciences - Publications

... Publications . Activities . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Image Enhancement by Total Variantion Quasi Solution Method . Publication type . Journal article . ... Publication date . 2008 . Journal . Pattern Recognition and Image Analysis . ... Title = {Image Enhancement by Total Variantion Quasi Solution Method}, . ... Journal = {Pattern Recognition and Image Analysis}, . ... Year = {2008}, . ...

Еще в разделе: (Показать все результаты (>83) - imaging.cmc.msu.ru/ )

• Image resampling and superresolution | Laboratory of Mathematical Methods of

... About the project . ... Biological information . As part of the project areas we will develop the scientific basis for the creation of infrastructure solutions and knowledge-based platforms for a comprehensive biodiversity study in Russia on the basis of genomic and storage technologies, analysis and exchange of data different types. ... Solution of problems set out in the project area will have the long-term effect in the various fields of science and engineering disciplines in the social sphere. ...

Еще в разделе: (Показать все результаты (>3) - depository.msu.ru/ )

... Head of the laboratory of Magnetic Semiconductors. ... magnetic semiconductors, spin glasses, chalcogenide spinels, manganites, magnetic two-phase state. ... In antiferromagnetic (AF) semiconductors the ferrons can exist leading off T = 0 and in F semiconductors the ones can present in vicinity of Curie point. ... L.I. Koroleva "Antiferron states of charge carriers in the ferromagnetic semiconductors CuCr2S4-xSex (0.5?x?1.5) with Curie points above room temperature", JETP, 79, No 1, p. 153-162, 1994...

Еще в разделе: (Показать все результаты (>24) - ferro.phys.msu.ru/ )

... Science . ... 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... Home Science and education Scientific Laboratories Laboratory of nonlinear polarization optics . ... The mechanisms of evolution of polarization during radiation propagation in nonlinear media with nonlocality of optical response. ... As a result, a new field of science has originated, the nonlinear polarization optics, providing new insights into the interplay of polarization effects in classic nonlinear optical processes. ...

Еще в разделе: (Показать все результаты (>1975) - ilc.phys.msu.ru/ )

• Laboratory of nonlinear optics crystal growth
• Laboratory of Nonlinear Spectroscopy of Ultrafast Processes in Condensed Matter
• Публикация

Version 1.3 of the Apache HTTP Server is the first version which includes a port to a (non-ASCII) mainframe machine which uses the EBCDIC character set as its native codeset. ... The port was started initially to . ... set/unset when the request body is received - depending on the content type of the request body (because the request body may contain ASCII text or a binary file) . ... In the case of text files of course, provisions must be made so that EBCDIC documents are always served in ASCII) . ...

Еще в разделе: (Показать все результаты (>36) - oit.cmc.msu.ru/ )

• Servers-CGI/Commandline
• CCVS API Functions
• IRC Gateway Functions

Evolution of the double neutron star merging rate and the cosmological origin of Gamma-ray burst sources " , Astroph.J., 1995, v.454, 593-596 (Lipunov, V.M. Postnov, K.A. and Prokhorov M.E.) . Evolution of SupernovaЃExplosion Rates in theЃ Universe (Jorgensen H., Lipunov.M., Panchenko I.E., Postnov K.A., Prokhorov M.E.) ApJ, 1997, v.486,p.110 . ... Formation of a Gravitationally Bound Object after Binary Neutron Star Merging and GRB phenomena " (G.V.Lipunova, V.M.Lipunov). ...

Еще в разделе: (Показать все результаты (>10) - observ.pereplet.ru/ )

. filename : Cross-device link . The file you are trying to make a link to is located on a different physical device. The solution is to create a symbolic link . directory_name is a directory . You are trying to make a link to a directory. Check the pathname for the file. ln: filename : File exists . A file with the same name as the linkname already exists in the destination directory. Use a different name for the linkname.

Еще в разделе: (Показать все результаты (>14) - comet.sai.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... This small program named TRAX is capable of solving systems of ordinary differential equations and plotting the solution on a phase plane as well as function of time. ... 1 комментарий " Phase plane explorer " . ... OPLS-AA patch for different types of molecules . ... All-atom automatic OPLS-AA topology generator . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2012 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>10) - erg.biophys.msu.ru/ )

• education ERG Research Group: Лаборатория теоретической биофизики

... allpy/structure.py . ... 1.1 --- a/ allpy /structure.py Wed Feb 23 12:08:47 2011 +0300 1.2 +++ b/ allpy /structure.py Wed Feb 23 18:13:56 2011 +0300 1.3 @@ -252,9 +252,12 @@ 1.4 result = [] 1.5 Block = self.__class__ 1.6 # for sorting 1.7 - key_column = lambda c: self. columns .index(c) 1.8 - key_ sequence = lambda s: self. sequences .index(s) 1.9 - vertices = set (sum([seq for seq in self. sequences ], [])) 1.10 + column2pos = {} 1.11 + for i, column in enumerate(self ...

Еще в разделе: (Показать все результаты (>2315) - kodomo.fbb.msu.ru/ )

• allpy: 936463fb68b2 allpy/rna.py
• allpy: 936463fb68b2 test/test.py
• allpy: 936463fb68b2 README.devel

... Scientific laboratories . ... lheat@cs.msu.su . ... 119991, Moscow, GSP-1, Leninskiye Gory, MSU, 2nd Educational Building, CMC Faculty, rooms 625 (Head of the laboratory), 657, 658, 687 . ... Petrova Ludmila, Senior Research Fellow, PhD . ... Numerical modeling of jet and shock-wave processes on the basis of the Euler equations. ... 3, June 2012. ( http://dx.doi.org/10.5539/jmr.v4n3p00 , ISSN 1916-9795 E-ISSN 1916-9809). ... 2012 . ... CMC MSU students at GSIS Summer School, Tohoku University, Japan...

Еще в разделе: (Показать все результаты (>81) - en.cs.msu.ru/ )

• Laboratory of Heat and Mass Transfer Processes Simulation
• Laboratory of Programming Technologies
• Laboratory of Programming Technologies | CMC MSU

... 220-221 ( ) 13 Exponentially growing localized solutions for linearized Navier { Stokes equations ( ) . Russian Journal of 6 . Mathematical Physics, 1, 3, 1993, . ... Proceedings of the 1c. First Russian - Mexican Conference on asymptotic methods, applied mathematics and mechanics, Mexico, 1993 . ... Russian Journal of 4c. Mathematical Physics, 2, 1, 1994, . ... Russian Journal of 6 Mathematical Physics, 3, 1, 1995, . ... 1-3, 1998 .. Russian Journal of 4c. Mathematical Physics, 5, 2, . ...

Еще в разделе: (Показать все результаты (>28) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/koudr/publ.pdf
• Голо В.Л. / Кафедра Дифференциальной геометрии и приложений /

... Lomonosov Moscow State University . ... Home About Communication and Information Department . ... Our main areas of expertise are information exchange, building network partnerships, development of complex internet applications and solutions, implementing e-learning practices.б  . ... Dr. of Science (biology) Alexander O. Makeev Graduated from Geographic Faculty of Lomonosov Moscow State University. ... Alexander Ladygin graduated from department of Biology of Lomonosov Moscow State University. ...

Еще в разделе: (Показать все результаты (>7) - ecfs.msu.ru/ )

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>3) - composite.msu.ru/ )

• INTAS 95-525 Project Main Page

... 4) Percolation probability: [pic] , where L is linear size of lattice. ... The presence of obstacles in a system leads to: - increase of the critical concentration value; this effect grows with increase of the full area of obstacles and falls with increase of the linear size of ones. - increase of the critical exponent ( value; this effect increase with growth both of linear size of obstacles and of their full area. - increase of the growth rate of ...

Еще в разделе: (Показать все результаты (>32) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/25june.html
• http://acat02.sinp.msu.ru/tut2.html

DAYS on DIFFRACTION' 2011 77 Analytical solutions for diffraction problem of nonlinear acoustic wave b eam in the stratified atmosphere Vladimir A. Gusev, Ruslan A. Zhostkow Department of Acoustics, Physical Faculty, Lomonosov's Moscow State University, Russia; e-mail: vgusev@bk.ru The nonlinear wave equation and mo dified Khokhlov­Zab olotskaya typ e equation for high intensive acoustics wave b eams propagating in stratified atmosphere with inhomogeneous of sound sp eed is set up. ...

Еще в разделе: (Показать все результаты (>52) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/lecture/matmodel.pdf
• http://acoustics.phys.msu.su/teachers/gusev_files/diff2012.pdf
• http://acoustics.phys.msu.su/teachers/gusev_files/nano2.pdf

q| PDB : 1r51 :A| PDB : 1auz :A URATE OXIDASE FROM ASPERGILLUS FLAVUS COMPLEXED WI savkaarygkdnvrvykvhkdektgvqtvyEMTVCVLLEGEIetsytkadnsvivatdsikntiyitakq npVTPPELFGSILGTHFIEKYN-HIHAAHVNIVChrwtrmdidgkphphsfirdseeKRNvqvd------ ------vveGKGIDIKSSlsgltvlkstnsqfwgflrdeyttlketwdrilstdvdATWQW-------KN FSglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkhyfei dlswhkglqntgknaevfapqsdpnglikctvgrs t| PDB : 1auz :A| PDB : ...

Еще в разделе: (Показать все результаты (>310) - kodomo.cmm.msu.ru/ )

• Банк MedLine (PubMed)
• DNA-protein contacts

... Alexander A. Moskovsky . ... Software Designer : . ... Projects: . Janitor II, Custodian III for Matrix Logic - utilities for DOCS Open EDMS (electronic document management system), C++/Win32 platform. ~2 man-year project with 5 persons team. iBuzz - (for ibuzz.com ) large client-server system (Win32, Enterprize Java Beans, Oracle, Sun/Solaris). ... Lunch Ordering Web System. ... Software Resources International , former Digital Moscow Software Center, . ... Physical Chemistry chair, . ...

Еще в разделе: (Показать все результаты (>8) - lcc.chem.msu.ru/ )

• People