Ultrafast Faraday Rotation In Magnetophotonic Microcavities Alexandr I. Musorin1, Margarita I. Sharipova1, Artem V. Chetvertukhin1, Tatyana V. Dolgova1, M. Inoue2, Andrey A. ... Hibarigaoka- - Tenpakucho, Toyohashi, Aichi Prefecture 441-8122, Japan musorin@nanolab.phys.msu.ru Abstract: Femtosecond dynamics of Faraday effect in magnetophotonic microcavities is experimentally demonstrated by using polarization-sensitive correlation scheme ...

Еще в разделе: (Показать все результаты (>100) - nanolab.phys.msu.ru/ )

• Ultrafast magnetophotonics | Laboratory of Nanophotonics & Metamaterials

... Data . ... MIR Station . ... Mir was the world's first consistently inhabited long-term research station in space, and the first 'third generation' type space station, constructed over a number of years with a modular design. ... Detectors of the instrument package allow observing fluxes of >0.1 MeV gamma-quants associated with bremstrahlung emission of high energy electrons of similar energies and with integral fluxes of high energy electrons (>5 MeV) and protons (>60 MeV). ... 60 MeV). ...

Еще в разделе: (Показать все результаты (>32) - smdc.sinp.msu.ru/ )

... Совместное обитание в Турции подтверждает видовые статусы Miniopterus schreibersii schreibersii и M. schreibersii pallidus (Mammalia: Chiroptera) // Syntopic occurrence in Turkey supports separate species status for Miniopterus schreibersii schreibersii and M. schreibersii pallidus (Mammalia: Chiroptera). ... Two subspecies previously recognized in Turkey, M. s. schreibersii and M. s. pallidus , differ significantly in nuclear and mitochondrial DNA, and in morphology. ...

Еще в разделе: (Показать все результаты (>900) - zmmu.msu.ru/ )

• Bird collections
• Murina - Tube-nosed bats
• Uropatagium venation pattern in bats as diagnostic character (by the example of

Traditional methods, connected with use of one microphone as an input of speech signal into a computer, do not give us a high reliability of recognition. If signal-to-noise relation (SNR) is 0-6 dB, the probability of an error even in identification of speech activity using only one microphone in typical cases is not less than 10% (as experiments and literature data show). ... The far-positioned (third) microphone can be used to estimate the average level of an external noise. ...

Еще в разделе: (Показать все результаты (>48) - www.intsys.msu.ru/ )

• Installation
• Intelligent Systems :: Research :: :: Research
• General Information

Chair of General Physics and Wave Processes, Physics Faculty of MSU . ... Main Science and education Scientific Laboratories Laboratory of nonlinear polarization optics . ... The mechanisms of evolution of polarization during radiation propagation in nonlinear media with nonlocality of optical response. ... As a result, a new field of science has originated, the nonlinear polarization optics, providing new insights into the interplay of polarization effects in classic nonlinear optical processes. ...

Еще в разделе: (Показать все результаты (>206) - ofvp.phys.msu.ru/ )

• Laboratory of solid-state lasers and coherent spectroscopy
• Семинар кафедры ОФиВП и МЛЦ

... 26.12.2012 14.00 . 344 [1] Trau, M., Saville, D. A. & Aksay, I. A. Field-Induced Layering of Colloidal Crystals. Science 272, 706.709 (1996). ... KGaA, 2007). 3] Linse, P. & Lobaskin, V. Electrostatic attraction and phase separation in solutions of like-charged colloidal particles. The Journal of Chemical Physics 112, 3917.3927 (2000). ... Phys. J. D 18, 339.345 (2002). ...

Еще в разделе: (Показать все результаты (>76) - electr003.chem.msu.ru/ )

... Automatic generation of profiling libraries . ... It allows the user to write any number of `meta' wrappers which can be applied to any number of MPI functions. Wrappers can be in separate files, and can nest properly, so that more than one layer of profiling may exist on indiividual functions. ... A list of functions for which to generate wrappers. ... Declarations for the functions that are to be profiled. ... Центры . ...

Еще в разделе: (Показать все результаты (>194) - www.parallel.ru/ )

• General | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Portable MPI Process Startup | PARALLEL.RU - Информационно-аналитический центр
• Introduction | PARALLEL.RU - Информационно-аналитический центр по параллельным

... fseqboot all.fasta -auto fdnaml CONSENSUS TREE: the numbers on the branches indicate the number of times the partition of the species into the two sets which are separated by that branch occurred among the trees, out of 100.00 trees +------E +-87.0-| ... Консенсусное дерево неукорененное. ... A Sets included in the consensus tree Set (species in order) How many times out of 100.00 .* ... 55.00 Sets NOT included in consensus tree: Set (species in order) How many times out of 100.00 .* ...

Еще в разделе: (Показать все результаты (>1540) - kodomo.cmm.msu.ru/ )

• Changeset 96:3619305694ad тАУ Python Battle
• Changeset 102:a308291203ea for life тАУ Cyclyc Cell Automata
• Changeset 102:a308291203ea тАУ Cyclyc Cell Automata

... Alders ( Alnus Mill.) are the common trees in Europe and Asia, and there are some taxonomically interesting forms on the border of the area. ... We have checked mentioned hypotheses using multivariate methods based on classic morphometrics data and two variants of geometric morphometrics of alder leaf. ... On the contrary, A. barbata must be considered as separate species. Our data show that the results of geometric morphometrics and classic morphometrics could be significantly different. ...

Еще в разделе: (Показать все результаты (>114) - herba.msu.ru/ )

• Haptanthus
• Morphological differences of Nymphaea alba L

... Inorganic Materials Sciences . ... At the same time at the Faculty of Physics and Mathematics of the Moscow University was founded the Inorganic Chemistry Division which was later transformed into a separate Department of Inorganic Chemistry of the MSU Faculty of Chemistry . ... The latter part of this program is successfully realized at both the Deartment and at the Department of Materials Sciences , the new faculty of MSU, which creation was initiated by the department of Inorganic Chemistry. ...

Еще в разделе: (Показать все результаты (>92) - www.inorg.chem.msu.ru/ )

TITLE OF THE ABSTRACT FIRST I. AUTHOR1, SECOND I.J. AUTHOR2 AND THIRD AUTHOR2 1Organization name of the first author first_ author@email.ru 2Organization name of the second and third authors second.author@email.com, third_author@mail.eu Key words: list up to eight words or group of words in order of priority, separated by commas. ... The abstract including figures, tables and reference should not exceed 1 page. The title should be centered in the page, in 11pt, boldface Roman, all capital letters. ...

Еще в разделе: (Показать все результаты (>16) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2012/lectures/Yakhot-abstract.doc
• http://hit-conf.imec.msu.ru/2012/lectures/index.html

... Separation of all runs on several groups by mean active sectors. ... Ways to carry out step 2: trying to cut off all points which don't reach the fit line with errors. Ways to carry out step 2: mean active sectors selection Ways to carry out step 2: results of mean active sectors selection by example of set 2 Failing of mean active sector selection method on example of set 3: one point is still on the graph Introduction of new distance parameter How to find an optimal distance parameter? ...

Еще в разделе: (Показать все результаты (>24) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/docs/highQC_2011_Bamberg.pdf
• ANTARES в МГУ

Laboratories \ Laboratory for behavior and behavior ecology of mammals \ Goals and Tasks . ... It was shown that in non-crossing in nature sympatric species of house mouse of the superspecies complex of Mus musculus s.l. , pre-copulative reproduction isolation was provided by its multiple duplicating at different levels of organization: the level of olfactory receptors, behavior of separate individuals in response to olfactory signals, pair interactions of potential sexual partners (Kotenkova E.V.). ...

Еще в разделе: (Показать все результаты (>2194) - www.sevin.ru/ )

• Laboratories: Laboratory for Biodiversity Concervancy and Bioresources Use:
• Laboratories: Laboratory for Synecology: Goals and Tasks
• Экологический Форум - Фундаментальная Экология: over weight and top heavy

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>115) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced

... Alexey Garber Moscow State University April 17, 2010 A. Garb er (MSU) Quasicrystals April 17, 2010 1 / 33 Ё This work is a joint work with Dirk Frettloh from Bielefeld University. A. Garb er (MSU) Quasicrystals April 17, 2010 2 / 33 Separated net Definition A subset A of metric space M is called separated net if for some constants r and R following condition holds: for every two points x1 , x2 A distance dM (x1 , x2 ) r and for every point y M dM (y , A) R . ...

Еще в разделе: (Показать все результаты (>28) - higeom.math.msu.su/ )

... Kaplanb, Hovagim Bakardjiana, 4 Andrzej Cichockia 5 Laboratory for Advanced Brain Signal Processing, RIKEN Brain Science Institute, 2-1 Hirosawa, Wako-shi, Saitama 351-0198, Japan b Department of Human and Animal Physiology, Faculty of Biology, Moscow State University, Russia a PROOF Combining the extremities on the basis of separation: 2 a new approach to EEG/ERP source localization 3 6 7 8 UNCORRECTED Abstract. ... The localization algorithm can be then applied to each of the separated sources. ...

Еще в разделе: (Показать все результаты (>56) - brain.bio.msu.ru/ )

• Sergei Shishkin
• Change-point detection algorithm performance with real EEG

Core information (Nucleus, Levels, Gamma transition, Decays, Data type) . ... any adopted (levels and gammas only) experimental . ... Query parameters: . Select for output . ... Levels (E, JPI, T1/2, etc.) ... Energy (keV) . ... Y D H M S MS US NS PS FS AS EV KEV MEV or Stable . ... Energy of the ?-ray (keV) . Relative photon intensity . ... Energy parameters of nucleus (B , Alpha energy, N, P separation energy) . ... Neutron separation energy (keV) . Proton separation energy (keV) . ...

58. http://selena.sai.msu.ru/San/Publications/ms34/MS047.pdf

59. The Laboratory of chemistry and physics of sensor and semiconductor materials |

60. Anis. Page2