Regularization methods with set extension for solving unstable problems of minimization" . ... Some modifications of regularization methods for solving problems of minimization with inaccurate input data are proposed on the basis of the approach of set extension. ... This allows us to construct regularized problems from the same class the original problem belongs to. For example, if the original problem is a problem of linear programming, then the regularized problem are those from the same class. ...

Еще в разделе: (Показать все результаты (>118) - num-meth.srcc.msu.ru/ )

• Increasing the interval of convergence for a generalized Newton's method of
• "Application of the Monte Carlo method for estimating the total time of solving
• "On the quaternary coding of cubic structures"

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>50) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Formulation of the problem ­ angle about the mass center C IC = mR 2 ­ central moment of inertia m and R ­ mass and radius of the hula-hoop k ­ coefficient of viscous friction r ­ radius of the waist FT ­ friction force N ­ reaction force ­ angle between x and CO x = a sin t , IC m m Ё +k (R - (R - y = b cos t = -FT R r ) = m (x sin + y cos ) + FT Ё Ё Ё r ) 2 = m (x cos - y sin ) + N Ё Ё (R - r ) = R ­ non-slippage where constants 0 mod 2 are defined from + µ cos 0 = 0. ...

Еще в разделе: (Показать все результаты (>9) - belyakov.imec.msu.ru/ )

... Now let us consider that damping or amplitude of the signal like a natural index of a hypothetical inequality or mean between the action and reaction, or the kinetic and the potential energy of the system. The time between the action and the reaction must be different from zero. ... We can describe this behaviour in its simpler form by the oscillation of a balance with inertiality or sensitivity, that is to say, with a time of reaction for the operations of adding or removing weights. ...

Еще в разделе: (Показать все результаты (>316) - chronos.msu.ru/ )

• M.Shulman
• Principle of causality
• Pic. 3.

... A.V. Chetvertukhin, M.I. Sharipova, A.G. Zhdanov, T.B. Shapaeva, T.V. Dolgova, and A.A. Fedyanin . ... A. I. Musorin, P. V. Perepelkin, M. I. Sharipova, A. V. Chetvertukhin, T. V. Dolgova, and A. A. Fedyanin . ... Margarita I. Sharipova, Alexander I. Musorin, Tatyana V. Dolgova, Andrey A. Fedyanin . Ultrafast dynamics of Faraday rotation in thin films" . ... Sharipova M.I., Musorin A.I., Dolgova T.V., Inoue M., Fedyanin A.A. "Ultrafast Dynamics of Faraday Rotation in Magnetophotonic Crystals" . ...

Еще в разделе: (Показать все результаты (>193) - nanolab.phys.msu.ru/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>14) - comphep.sinp.msu.ru/ )

• extra:model:main [CompHEP]

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>7) - imaging.cs.msu.ru/ )

... P shear fractures . ... Palm tree structure . ... Passive reorientation, during deformation . ... Plane, conjugate, of maximum shear stress . ... Pore fluid pressure . Pore fluid pressure, effective stress and . ... Pore fluid pressure, stress and . ... Pore pressure, shear failure and frictional sliding, effect of pressure on . Pore pressure, shear fracture and . ... Primary and nontectonic structures . ... Principal stress, shear, principal, and normal stresses, relationship between . ...

Еще в разделе: (Показать все результаты (>221) - geo.web.ru/ )

• Dictionary_R
• Dictionary_V
• Dictionary_T

Why are genome regulatory regions AT-enriched? Alexander A. Osypov Laboratory of Cell Genome Functioning, Institute of Cell Biophysics of RAS, 142290, Pushchino MR, Russia, aosypov@gmail.com Genome DNA physical properties define its shape in the functional space and influence its interactions with proteins, esp. for transcription regulation. ... Binding frequency of RNA polymerase to DNA along the genome, measured in direct experiment, correlates to the calculated electrostatic potential. ...

Еще в разделе: (Показать все результаты (>118) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/45.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/200.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/12.pdf

... Payment is made at transfer of means for the University account All expenses of transferring the money to the University account are beard by the Student. In the event the Student is expelled by the University for the lack of academic progress; transgression of the sections stated in Article 3; for the Student's own personal reasons; for medical reasons confirmed by the official medical paper, all payments made are non-refundable. Article 2 Obligation and rights of the University 2.1. ...

Еще в разделе: (Показать все результаты (>10) - foroff.phys.msu.ru/ )

Control of Diffeomorphisms and Densities Andrei A. Agrachev SISSA, Trieste, Italy and Steklov Mathematical Institute, Moscow, Russia e-mail: agrachev@sissa.it Consider a classical control system as it was defined by Pontryagin: x = f (x, u), x M , u U. (1) Assume that the state space M is a smooth manifold , the set of control parameters U is a closed subset of another smooth manifold , the righthand side f is ...

Еще в разделе: (Показать все результаты (>7) - pont2008.cmc.msu.ru/ )

• http://pont2008.cs.msu.ru/files/en/abstracts/Gamkrelidze.pdf

Russian Math . ... Nauk 70:6 203­212 COMMUNICATIONS OF THE MOSCOW MATHEMATICAL SOCIETY Equations of motion of non-holonomic systems A. V. Borisov and I. S. Mamaev We consider a non-holonomic mechanical system whose configuration space is some (smooth) manifold N . ... In order to explicitly write the vector field on M defined by (1), we choose in each tangent space to T Nq a new basis of vector fields (q), = 1, . ... n), then the equations of motion are represented in the pseudo-Hamiltonian form. ...

Еще в разделе: (Показать все результаты (>106) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/303/2471-1.pdf
• http://ics.org.ru/upload/iblock/d42/1511.02655v1.pdf
• http://ics.org.ru/upload/iblock/db4/RCD739.pdf

... Nonlinear Dynamics of Grains in a Liquid-Saturated Soil . ... Such nonlinear behaviour is well-defined at significant local deformation caused by high applied load, even if the load does not vary in time. However, there exist a different type of nonlinearity which manifests itself due to inertial forces between grains. ... The inertial attractive forces have hydrodynamic origin, and the repulsive forces are caused by deformation of colliding grains. ...

Еще в разделе: (Показать все результаты (>67) - acs366.phys.msu.su/ )

Analysis of the ANTARES data for SN neutrino detection V. Kulikovskiy (MSU / INFN Genova) Hit counts in the detector. The number of hits ( hit counts ) in a time slice (104.8 ms) is used (this information is stored in each run) Mean number of hit counts in one PMT is ~5500 (corresponds to ~55 kHz) Expected number of hits from SN in 100ms is 11.6 ( 550 0) Bioluminescence bursts should be excluded Bioluminescence cut We have collected distributions of hit counts for each ...

Еще в разделе: (Показать все результаты (>11) - antares.sinp.msu.ru/ )

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>66) - hist.msu.ru/ )

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Kulikova Natalia A. , Perminova Irina V. , Badun Gennady A. , Chernysheva Maria G. , Koroleva Olga V., Tsvetkova Eugenia A. в журнале Applied and Environmental Microbiology , издательство American Society for Microbiology (United States) , том 76, ? ...

Еще в разделе: (Показать все результаты (>213) - istina.msu.ru/ )

• Spika J.S. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Lampropoulou Vicky - сотрудник | ИСТИНА - Интеллектуальная Система
• Fillatreau Simon - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... About 70 scientific papers. The theory of square parachute is created, describing distribution of parameters of shape, tension and resistance to airflow of canopy in steady-state condition for various sets of suspension line lengths and air-permeability. ... The practical recommendations for optimal parachute application are submitted. ... It is discovered experimentally that a character of pressure distribution for a square canopy depends on a particular choice of suspension line lengths. ...

Еще в разделе: (Показать все результаты (>2) - margaret.imec.msu.ru/ )