... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>292) - higeom.math.msu.su/ )

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>103) - neptun.sai.msu.ru/ )

• Manual Page: ab - Apache HTTP Server
• Apache module mod_expires
• Apache module mod_negotiation

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>101) - sai.msu.ru/ )

• European Astronomical Society(EAS): NEWS

... Endangered Languages Documentation and Description: Should these Activities be Separated // Shixuan XU, Tjeerd D. Graaf, and Cecilia Brassett (eds). Languages Endangerment and Maintenance. Beijing: Zhongguozhishichanquan Press, 2011 (1 п.л.). ...

Еще в разделе: (Показать все результаты (>101) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Documentation and description of the Northern Selkup local
• V.B.Semikoz, D.D.Sokoloff, J.W.F. Valle, Lepton asymmetries and primordial

... E. Huhlaev, Metamake Tools for Personal Project Preparation in Heterogeneous Network Environment (ID=260), Word doc . ... O. Kodolova, Experience with OO Database for CMS Events Distributed Between Two Sites (ID=294), PDF file . ... A. Nikitin, The GA Based Approach to Optimization of Parallel Calculations in Large Physics Problems (ID=220), Word doc . ... J. Seixas, Neural Particle Discrimination for Triggering Interesting Physics Channels Using Calorimetry Data (ID=311), PDF file . ...

Еще в разделе: (Показать все результаты (>59) - acat02.sinp.msu.ru/ )

... Статус проекта: Инициативный проект Д. А. Симонова. На кафедре динамической геологии принят в качестве базового при преподавании обязательного учебного курса "Применение геоинформационных систем при геологических исследованиях". ... Целью проекта является , наряду с обучением студентов основам применения и использования геоинформационных систем , создать пакет интерактивных карт для Восточно-Европейской платформы, применимых как в образовании так и в различных областях геологической науки. ...

Еще в разделе: (Показать все результаты (>24) - dynamo.geol.msu.ru/ )

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>15) - ocean.phys.msu.ru/ )

... Войти в систему . ... Издательство: Central European Science Journals . ... в журнале Central European Journal of Physics , издательство Central European Science Journals (Poland) , том 11, ? ... Tarasov Vasily E. в журнале Central European Journal of Physics , издательство Central European Science Journals (Poland) , том 11, ? ... Tarasov V.E. в журнале Central European Journal of Physics , издательство Central European Science Journals (Poland) , том 10, ? ...

Еще в разделе: (Показать все результаты (>3103) - istina.msu.ru/ )

• Vazquez M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Rodrigo A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Sofiev M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

Laboratory of Liquid Crystals . ... LCOptimizer is a realization of algorithm for calculation of nematic and cholesteric LC structure in PDLC droplets. ... Current version of LCOptimizer software consists of the following units: . ... lcdis3 -- quick change of external field, surface tension or director field distribution in already prepared input file . ... User Manual . User Manual contains general information about the program, input and output description, and some additional tips. ...

Еще в разделе: (Показать все результаты (>171) - polly.phys.msu.ru/ )

• Science

... 1.2 Free-electron lasers . 1.3 Historical development of the XFEL . References . ... 2.3.5 Experience form the first user operation periods . ... 3 General layout of the XFEL Facility . ... 3.4 Beam distribution system . ... 4 XFEL ccelerator . ... 4.4.2 Space charge and coherent synchrotron radiation effects . ... 4.8.2 Layout of the XFEL synchronisation system. ... 5.1.1 Principles of XFEL operation . 5.1.2 Design criteria for the European XFEL . ... 6.1 Overview of the X-ray systems . ...

Еще в разделе: (Показать все результаты (>182) - nuclphys.sinp.msu.ru/ )

• Европейская школа по оборудованию для физики частиц и космофизики (2014)

... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... On this page we collect references to our resources, documentation and resources on other sites. All these data are very helpful for everybody who wants to learn practical quantum chemistry. Firefly (PC GAMESS) main page . ... ERG group wrote some articles about visualization: . ... Нет комментариев " Quantum chemistry information page " . ... Quantum chemistry information page . ... 2015 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>35) - erg.biophys.msu.ru/ )

• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>5) - tex.bog.msu.ru/ )

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>138) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example
• Input Formats

. This is the default web page for this server. The web server software is running but no content has been added, yet.

58. http://cryst.geol.msu.ru/courses/crchem/urusov2.pdf

59. http://www.nano.msu.ru/files/news/20121014-sample.pdf

60. Quantum Information Lab, Int'l Laser Ctr. and Faculty of Physics, M.V.Lomonosov