... fseqboot all.fasta -auto fdnaml CONSENSUS TREE: the numbers on the branches indicate the number of times the partition of the species into the two sets which are separated by that branch occurred among the trees, out of 100.00 trees +------E +-87.0-| ... Консенсусное дерево неукорененное. ... A Sets included in the consensus tree Set (species in order) How many times out of 100.00 .* ... 55.00 Sets NOT included in consensus tree: Set (species in order) How many times out of 100.00 .* ...

Еще в разделе: (Показать все результаты (>681) - kodomo.cmm.msu.ru/ )

• Changeset 96:3619305694ad тАУ Python Battle
• main.py тАУ Python Battle
• Changeset 102:a308291203ea for life тАУ Cyclyc Cell Automata

log . ... Wed, 16 Mar 2011 21:34:06 +0300 . boris (kodomo) . ... Fri, 04 Mar 2011 15:16:28 +0300 . ... Daniil Alexeyevsky . Automated merge with ssh://kodomo/allpy . Mon, 28 Feb 2011 22:40:16 +0300 . ... Tue, 01 Mar 2011 00:17:13 +0300 . boris . ... Sat, 26 Feb 2011 18:59:48 +0300 . ... Sun, 27 Feb 2011 23:49:54 +0300 . ... Fri, 25 Feb 2011 18:00:20 +0300 . ... Thu, 24 Feb 2011 23:51:52 +0300 . ... Wed, 23 Feb 2011 23:10:47 +0300 . ... Tue, 22 Feb 2011 23:00:34 +0300 . ...

Еще в разделе: (Показать все результаты (>3057) - kodomo.fbb.msu.ru/ )

• snake: 3619305694ad snake.py
• snake: snake.py annotate
• snake: log

TITLE OF THE ABSTRACT FIRST I. AUTHOR1, SECOND I.J. AUTHOR2 AND THIRD AUTHOR2 1Organization name of the first author first_ author@email.ru 2Organization name of the second and third authors second.author@email.com, third_author@mail.eu Key words: list up to eight words or group of words in order of priority, separated by commas. ... The abstract including figures, tables and reference should not exceed 1 page. The title should be centered in the page, in 11pt, boldface Roman, all capital letters. ...

Еще в разделе: (Показать все результаты (>11) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2012/lectures/Yakhot-abstract.doc
• http://hit-conf.imec.msu.ru/2012/lectures/index.html

... Separation of all runs on several groups by mean active sectors. ... Ways to carry out step 2: trying to cut off all points which don't reach the fit line with errors. Ways to carry out step 2: mean active sectors selection Ways to carry out step 2: results of mean active sectors selection by example of set 2 Failing of mean active sector selection method on example of set 3: one point is still on the graph Introduction of new distance parameter How to find an optimal distance parameter? ...

Еще в разделе: (Показать все результаты (>7) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/docs/highQC_2011_Bamberg.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>117) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced

... Alexey Garber Moscow State University April 17, 2010 A. Garb er (MSU) Quasicrystals April 17, 2010 1 / 33 Ё This work is a joint work with Dirk Frettloh from Bielefeld University. A. Garb er (MSU) Quasicrystals April 17, 2010 2 / 33 Separated net Definition A subset A of metric space M is called separated net if for some constants r and R following condition holds: for every two points x1 , x2 A distance dM (x1 , x2 ) r and for every point y M dM (y , A) R . ...

Еще в разделе: (Показать все результаты (>21) - higeom.math.msu.su/ )

... Department of Vertebrate Zoology . ... In 1808 the Chair of Zoology and Botany was subdivided into two independent departments and later a Chair of Anatomy was founded by professor D. I. Dvigubsky. ... However in 1878 he was the head of Zoological Department too. ... In the reports of these years one can find not only the Vertebrate Zoology and Comparative Anatomy Departments but also the Departments of Fur Trade Zoology, of Morphology and of Vertebrate Systematics. associate professor E.S.Ptushenko...

Еще в разделе: (Показать все результаты (>36) - vertebrata.bio.msu.ru/ )

• Student Reports at International Conferences
• Выступления студентов и аспирантов на конференциях

... Bolshakov D.K., Modin I.N., Pervago E.V., Shevnin V.A. Anisotropy effects investigations by resistivity method in some inhomogeneous media. ... Bolshakov D.K., Modin I.N., Pervago E.V., Shevnin V.A. The new approach to the analysis of the azimuthal resistivity data over anisotropic media. ... Bolshakov D.K., Modin I.N., Pervago E.V., Shevnin V.A. Modeling and interpretation of azimuthal resistivity sounding over two-layered model with arbitrary - oriented anisotropy in each layer.. ...

Еще в разделе: (Показать все результаты (>42) - geophys.geol.msu.ru/ )

• Anis. Page2
• TES. Median algorithm

Backlinks to WikiGroups in all Webs ( Search Main Web only ) . ... Administrator Group * Member list (comma separated list): * Set GROUP = RomanKondakov * Persons/group who can change the list: * Set ALLOWTOPICCHANGE ... r2 - 22 Aug 2009 - 23:36 by AdminUser . ... NEW - 09 Jan 2009 - 12:00 by ProjectContributor . ... GroupViewTemplate . ... PracticumVGroup * Member list (comma separated list): * Set GROUP = Main.RomanKondakov Main.МихаилВасильевич * Persons/group who can change the list: .. ...

Еще в разделе: (Показать все результаты (>1604) - wiki.cs.msu.ru/ )

• (backlinks in Main Web) WikiGroups < Main < Foswiki
• (backlinks in System Web) VarWIKINAME < System < Foswiki
• (backlinks in Main Web) DontsovEvgeny < Main < Foswiki

Some additional inquiry information . ... WPGMA . As any cluster method , UPGMA (unweighted pair-group method of analysis) performs the structure of a set of some homogeneous elements ( in our case alignment is a set of amino acid sequences ). ... Firstly, when we calculate correlations between distance matrices on the whole alignment and on separate position (for selecting "diagnostic" positions) - we should be sure that these data are not distorted by multiple repeating of one sequence. ...

Еще в разделе: (Показать все результаты (>27) - monkey.belozersky.msu.ru/ )

• ETS numeration assumed
• About authors ot this complex
• SDPpred

... Kaplanb, Hovagim Bakardjiana, 4 Andrzej Cichockia 5 Laboratory for Advanced Brain Signal Processing, RIKEN Brain Science Institute, 2-1 Hirosawa, Wako-shi, Saitama 351-0198, Japan b Department of Human and Animal Physiology, Faculty of Biology, Moscow State University, Russia a PROOF Combining the extremities on the basis of separation: 2 a new approach to EEG/ERP source localization 3 6 7 8 UNCORRECTED Abstract. ... The localization algorithm can be then applied to each of the separated sources. ...

Еще в разделе: (Показать все результаты (>34) - brain.bio.msu.ru/ )

• Change-point detection algorithm performance with real EEG

... Moskovsky Alexander . ... Rogov Alexander . Modeling the reaction of hydrolysis of peptide bonds by trypsin by using quntum mechanical - molecular mechanical methods . ... Title: "Modeling Spectra of Molecular Clusters by Quantum Chemistry and Molecular Dynamics Methods" . ... Title: "Development of the Combined Quantum Mechanical - Molecular Mechanical Methods" . ... Title: "Modeling mechanisms of enzymatic hydrolysis reactions by the combined quantum mechanical - molecular mechanical methods" . ...

Еще в разделе: (Показать все результаты (>2) - lcc.chem.msu.ru/ )

Microsymposium 34, MS047, 2001 SOME PROBLEMS OF THE EVOLUTION OF ASTEROIDS ­ RUBBLE PILE. ... Evidently, we can distinguish two processes: distant interactions, where there is no direct contact between separate fragments, and close contact interactions, where the fragments collide with one another. ... Such a rubble pile with a dust atmosphere differs from a cometary nucleus only in the absence of a volatile gas component, which is usually considered the cause of the appearance of cometary dust. ...

Еще в разделе: (Показать все результаты (>47) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Pug/Publications/ms34/MS058.pdf
• http://selena.sai.msu.ru/Pug/Publications/ms38/ms080.pdf

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD Dmitry N. Dirin . ... Cadmium chalcogenide colloidal quantum dots (semiconductor nanocrystals). Electronic and optical properties of quantum dots. ... Semiconductor nanoheterostructures. ... Grant UMNIK-2008 "Development of prototype of the solar cell photosensitive element based on CdTe/CdSe colloidal quantum dots". ... 2008-2014 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>21) - www.lssm.inorg.chem.msu.ru/ )

... Living systems depository "Noah's Ark" . ... About the project . ... The project of the Moscow State University "Noah's Ark" is dedicated to the creation of multi-functional network storage of biological material. ... Creation of temporary prototypes of living systems depository bank for storage and research of the collected material. ... Development of algorithms for the information processes analysis in living systems for receiving, filing and processing of various types of biological data. ...

Еще в разделе: (Показать все результаты (>2) - depository.msu.ru/ )

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>2) - physcontrol.phys.msu.ru/ )

• List All Categories

Title of the Abstract Surname I., Surname I.1 Company, address, city, ZIP-code, Country, phone, E-mail 1Company, address, city, ZIP-code, Country, phone, E-mail Body text goes here (first line of each paragraph should be indented by 1 cm). ... There should be no page number in page header or footer; text of the abstract should not exceed one page. You may use footnotes[1] if necessary. ... Remove the paragraph with horizontal ruler if you prefer no bibliography list. ... 1] Authors. Title. ...

Еще в разделе: (Показать все результаты (>34) - www.msm.biophys.msu.ru/ )

... Stanley Milgram SIX DEGREES OF SEPARATION OR SMALL WORLD PHENOMENON 1998, Small world networks Steven Strogatz Duncan Watts Laszlo Barabasi and Reka Albert 1999 In 1999 American physicits Barabasi and Albert have shown that distribution of nodes by the number of links in tke most real networks is described by power law and they called such networks as scale-free networks Reprinted from Linked: The New Science of Networks by Albert-Laszlo ... Human disease network. ... disease ­ , ). ...

59. Send by email | CMC MSU

60. http://pont2008.cs.msu.ru/files/en/abstracts/Zakalyukin.pdf