... Совместное обитание в Турции подтверждает видовые статусы Miniopterus schreibersii schreibersii и M. schreibersii pallidus (Mammalia: Chiroptera) // Syntopic occurrence in Turkey supports separate species status for Miniopterus schreibersii schreibersii and M. schreibersii pallidus (Mammalia: Chiroptera). ... Two subspecies previously recognized in Turkey, M. s. schreibersii and M. s. pallidus , differ significantly in nuclear and mitochondrial DNA, and in morphology. ...

Еще в разделе: (Показать все результаты (>849) - zmmu.msu.ru/ )

• Bird collections
• Uropatagium venation pattern in bats as diagnostic character (by the example of
• Murina - Tube-nosed bats

. Предыдущий слайд . Следующий слайд . Первый слайд . Графический вариант .

Еще в разделе: (Показать все результаты (>58) - analyt.chem.msu.ru/ )

• Moscow State University: Analytical Chemistry Division
• Применения органических реагентов
• Кафедра аналитической химии МГУ

... Эндоскопическое применение хирургических лазеров при стойких обструктивных процессах в гортанной части глотки, гортани и трахее у детей . ... Лазерная медицина в оториноларингологии : Лазерная медицина в отриноларингологии . Применение лазерной хирургической установки "Глассер" (l = 1,54 мкм) в оториноларингологии: лазерное излучение, взаимодействие с биотканями, оториноларингология, методики применения . Лазерная родинка . ... Лазерная медицина в оториноларингологии : Лазерная хирургия . ...

Еще в разделе: (Показать все результаты (>4680) - www.nature.web.ru/ )

• Применение мидокалма при купировании вертеброгенных болевых синдромов
• Беременность после применения рекомбинантного человеческого ФСГ (ГОНАЛ-Ф) в
• Новый отечественный комплексный препарат виферон и его применение в

astro-ph/0312382 "Озирис" (HD209458b), испаряющаяся планета ("Osiris" (HD209458b), an evaporating planet) . ... Authors: Masataka Fukugita et al. astro-ph/0312071 Увеличение оценки частоты слияния двойных нейтронных звезд по наблюдениями системы с большими релятивистскими эффектами (An increased estimate of the merger rate of double neutron stars from observations of a highly relativistic system) . ... Authors: C. Megan Urry . ... astro-ph/0312059 Проект Skysoft (The Skysoft Project) . ...

Еще в разделе: (Показать все результаты (>160) - astro.uni-altai.ru/ )

... fseqboot all.fasta -auto fdnaml CONSENSUS TREE: the numbers on the branches indicate the number of times the partition of the species into the two sets which are separated by that branch occurred among the trees, out of 100.00 trees +------E +-87.0-| ... Консенсусное дерево неукорененное. ... A Sets included in the consensus tree Set (species in order) How many times out of 100.00 .* ... 55.00 Sets NOT included in consensus tree: Set (species in order) How many times out of 100.00 .* ...

Еще в разделе: (Показать все результаты (>1068) - kodomo.cmm.msu.ru/ )

• Changeset 96:3619305694ad тАУ Python Battle
• Changeset 102:a308291203ea тАУ Cyclyc Cell Automata
• main.py тАУ Python Battle

log . ... Wed, 16 Mar 2011 21:34:06 +0300 . boris (kodomo) . ... Fri, 04 Mar 2011 15:16:28 +0300 . ... Daniil Alexeyevsky . Automated merge with ssh://kodomo/allpy . Mon, 28 Feb 2011 22:40:16 +0300 . ... Tue, 01 Mar 2011 00:17:13 +0300 . boris . ... Sat, 26 Feb 2011 18:59:48 +0300 . ... Sun, 27 Feb 2011 23:49:54 +0300 . ... Fri, 25 Feb 2011 18:00:20 +0300 . ... Thu, 24 Feb 2011 23:51:52 +0300 . ... Wed, 23 Feb 2011 23:10:47 +0300 . ... Tue, 22 Feb 2011 23:00:34 +0300 . ...

Еще в разделе: (Показать все результаты (>2856) - kodomo.fbb.msu.ru/ )

• snake: 3619305694ad snake.py
• snake: snake.py annotate
• snake: log

... Alders ( Alnus Mill.) are the common trees in Europe and Asia, and there are some taxonomically interesting forms on the border of the area. ... We have checked mentioned hypotheses using multivariate methods based on classic morphometrics data and two variants of geometric morphometrics of alder leaf. ... On the contrary, A. barbata must be considered as separate species. Our data show that the results of geometric morphometrics and classic morphometrics could be significantly different. ...

Еще в разделе: (Показать все результаты (>220) - herba.msu.ru/ )

• Haptanthus
• Morphological differences of Nymphaea alba L
• The employment of quantitative methods for the lake ecosystem research

Laboratories \ Laboratory for behavior and behavior ecology of mammals \ Goals and Tasks . ... It was shown that in non-crossing in nature sympatric species of house mouse of the superspecies complex of Mus musculus s.l. , pre-copulative reproduction isolation was provided by its multiple duplicating at different levels of organization: the level of olfactory receptors, behavior of separate individuals in response to olfactory signals, pair interactions of potential sexual partners (Kotenkova E.V.). ...

Еще в разделе: (Показать все результаты (>1259) - www.sevin.ru/ )

• Laboratories: Laboratory for Evolutionary Morphology: Goals and Tasks
• Laboratories: Laboratory for Soil Zoology and General Entomology: Goals and
• Laboratories: Laboratory for Biodiversity Concervancy and Bioresources Use:

... Gating mechanisms of a natural anion channelrhodopsin. ... Anion channelrhodopsins (ACRs) are a class of light-gated channels recently identified in cryptophyte algae that provide unprecedented fast and powerful hyperpolarizing tools for optogenetics. ... The first mechanism, characterized by slow opening and fast closing of the channel, is regulated by Glu-68. ...

Еще в разделе: (Показать все результаты (>63) - biochem.bio.msu.ru/ )

... Separation of all runs on several groups by mean active sectors. ... Ways to carry out step 2: trying to cut off all points which don't reach the fit line with errors. Ways to carry out step 2: mean active sectors selection Ways to carry out step 2: results of mean active sectors selection by example of set 2 Failing of mean active sector selection method on example of set 3: one point is still on the graph Introduction of new distance parameter How to find an optimal distance parameter? ...

Еще в разделе: (Показать все результаты (>9) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/docs/highQC_2011_Bamberg.pdf

Next: Метод нейронных сетей Up: phd Previous: Основные результаты Contents . В предыдущей главе был описан поиск одиночного рождения топ кварков классическими методами анализа с помощью применения кинематических обрезаний, выделяющих область фазового пространства, наиболее характерную для сигнальных событий. ... Метод нейронных сетей . ... Проверка нейронных сетей . Применение метода нейронных сетей . ... Эффективность применения нейронных сетей . Результаты применения нейронных сетей . ...

Еще в разделе: (Показать все результаты (>38) - top.sinp.msu.ru/ )

• Эффективность применения нейронных сетей
• Применение метода нейронных сетей
• Результаты применения нейронных сетей

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>157) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• shuvalov_dept

... Alexey Garber Moscow State University April 17, 2010 A. Garb er (MSU) Quasicrystals April 17, 2010 1 / 33 Ё This work is a joint work with Dirk Frettloh from Bielefeld University. A. Garb er (MSU) Quasicrystals April 17, 2010 2 / 33 Separated net Definition A subset A of metric space M is called separated net if for some constants r and R following condition holds: for every two points x1 , x2 A distance dM (x1 , x2 ) r and for every point y M dM (y , A) R . ...

Еще в разделе: (Показать все результаты (>77) - higeom.math.msu.su/ )

... Курс ориентирован на освоение студентами основных методов работы на компьютере и различных периферийных устройствах ( принтеры, плоттеры, сканеры, дигитайзеры и т.д.), знакомство с существующими ... так и общего назначения) для решения конкретных геологических задач (построение различной геологической графики, работа с базами данных , моделирование геологических процессов, оформление отчетов, статей и т.п. ) ... Редактирование, поиск, замена, печать. ... Импорт, экспорт объектов и данных. ...

Еще в разделе: (Показать все результаты (>31) - sbmg.geol.msu.ru/ )

... Department of Vertebrate Zoology . ... In 1808 the Chair of Zoology and Botany was subdivided into two independent departments and later a Chair of Anatomy was founded by professor D. I. Dvigubsky. ... However in 1878 he was the head of Zoological Department too. ... In the reports of these years one can find not only the Vertebrate Zoology and Comparative Anatomy Departments but also the Departments of Fur Trade Zoology, of Morphology and of Vertebrate Systematics. associate professor E.S.Ptushenko...

Еще в разделе: (Показать все результаты (>63) - vertebrata.bio.msu.ru/ )

• Student Reports at International Conferences
• Выступления студентов и аспирантов на конференциях

Some additional inquiry information . ... WPGMA . As any cluster method , UPGMA (unweighted pair-group method of analysis) performs the structure of a set of some homogeneous elements ( in our case alignment is a set of amino acid sequences ). ... Firstly, when we calculate correlations between distance matrices on the whole alignment and on separate position (for selecting "diagnostic" positions) - we should be sure that these data are not distorted by multiple repeating of one sequence. ...

Еще в разделе: (Показать все результаты (>22) - monkey.belozersky.msu.ru/ )

• ETS numeration assumed
• About authors ot this complex
• SDPpred

Backlinks to WikiGroups in all Webs ( Search Main Web only ) . ... Administrator Group * Member list (comma separated list): * Set GROUP = RomanKondakov * Persons/group who can change the list: * Set ALLOWTOPICCHANGE ... r2 - 22 Aug 2009 - 23:36 by AdminUser . ... NEW - 09 Jan 2009 - 12:00 by ProjectContributor . ... GroupViewTemplate . ... PracticumVGroup * Member list (comma separated list): * Set GROUP = Main.RomanKondakov Main.МихаилВасильевич * Persons/group who can change the list: .. ...

Еще в разделе: (Показать все результаты (>1609) - wiki.cs.msu.ru/ )

• (backlinks in Main Web) WikiGroups < Main < Foswiki
• (backlinks in System Web) VarWIKINAME < System < Foswiki
• (backlinks in Main Web) DontsovEvgeny < Main < Foswiki

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... Восполнение недостатка витаминов путем дополнительного несбалансированного приема продуктов, содержащих те или иные вещества, зачастую приводит к неадекватному увеличению потребления пищевых веществ и энергии, что нередко влечет за собой избыточное увеличение массы тела беременной женщины и плода. ... Возможность возникновения аллергической реакции в ответ на прием витаминно-минерального комплекса особенно велика в случае беременных. ...

Еще в разделе: (Показать все результаты (>4725) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Применение стволовых клеток при облысении
• Клуб выпускников МГУ: Применение пептидных биорегуляторов
• Клуб выпускников МГУ: Обсуждение материала "Применение импульсного

... Kaplanb, Hovagim Bakardjiana, 4 Andrzej Cichockia 5 Laboratory for Advanced Brain Signal Processing, RIKEN Brain Science Institute, 2-1 Hirosawa, Wako-shi, Saitama 351-0198, Japan b Department of Human and Animal Physiology, Faculty of Biology, Moscow State University, Russia a PROOF Combining the extremities on the basis of separation: 2 a new approach to EEG/ERP source localization 3 6 7 8 UNCORRECTED Abstract. ... The localization algorithm can be then applied to each of the separated sources. ...

Еще в разделе: (Показать все результаты (>60) - brain.bio.msu.ru/ )

• Sergei Shishkin
• Change-point detection algorithm performance with real EEG

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD Dmitry N. Dirin . ... Cadmium chalcogenide colloidal quantum dots (semiconductor nanocrystals). Electronic and optical properties of quantum dots. ... Semiconductor nanoheterostructures. ... Grant UMNIK-2008 "Development of prototype of the solar cell photosensitive element based on CdTe/CdSe colloidal quantum dots". ... 2008-2014 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>33) - www.lssm.inorg.chem.msu.ru/ )