Sorex araneus . Epigenetic variation of the common shrew, Sorex araneus , in different habitats . ... Epigenetic variation of the common shrew, Sorex araneus , was studied in three habitats (floodplain forest, wet sedge bog and dry meadow) at Bia?owie?a, north-eastern Poland. ... Chromosome and allozyme variation of the common shrew, Sorex araneus, in different habitats // Hereditas. ... Morphometric variation of the common shrew, Sorex araneus, in different habitats // Mammalia. ...

Еще в разделе: (Показать все результаты (>1368) - zmmu.msu.ru/ )

• Cranial morphology of five felids: Acinonyx jubatus, Panthera onca, Panthera

NAME: Oleg Il'ich Kutsenok . CHEMICAL KINETICS DIVISION . LABORATORY OF PHOTOCHEMISTRY . You are appeared to be visitor from the April 25,1996.. ... Department of Chemistry . ... Moscow M.V.Lomonosov University . ... RESEARCH ACTIVITIES AND INTERESTS: photoinduced electron transfer reactions in polar media, exciplex formation . ... J. of Physical Chemistry (in Russian), 70 (11), pp.2008-2013, 1996. ... Kinetic and Thermodynamic Properties of Aromatic Compounds Exciplexes in Acetonitrile". ...

Еще в разделе: (Показать все результаты (>609) - chem.msu.ru/ )

• Colloid-chemical phenomena in wastewater containing lignosulphonates
• Peculiarities of Diffusive Transport of Water and Other Gases in Glassy and
• Peculiarities of diffusive transport of water and other gases in glassy and

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>159) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Notes on searching by similarity

Электронная библиотека Попечительского совета . ... Bechtold T. (ed.), Mussak R. (ed.) - Handbook of natural colorants . ... Название: Handbook of natural colorants . Авторы: Bechtold T. (ed.), Mussak R. (ed.) . ... Written by scientists with specialised knowledge in the field, Handbook of Natural Colorants provides a unique source of information, summarising the present knowledge of natural colorants in depth. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12284) - lib.mexmat.ru/ )

• Shapley H. - Studies of the Magnitudes in Star Clusters IV. On the Color of
• Kitayama S., Duffy S., Kawamura T. - Perceiving an Object and its Context in
• Jauncey G.E.M. - The Energy Reappearing as Characteristic X-Rays when X-Rays

О лаборатории . ... Лаборатория теоретической биофизики . ... OPLS-AA topology generation is a very complex task because of huge amount of the atomtypes described this force field. ... We use OPLS-AA with some includings; ?includings? are overlays on the standart GROMACS forcefield files. ... All-atom automatic OPLS-AA topology generator . ... comcon1 in All-atom automatic OPLS-AA topology? . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>58) - erg.biophys.msu.ru/ )

• Python membrane generator for MD simulations ERG Research Group: Лаборатория
• OPLS ERG Research Group: Лаборатория теоретической биофизики
• topology ERG Research Group: Лаборатория теоретической биофизики

Each Apache configuration directive is described using a common format that looks like this: . ... This indicates the format of the directive as it would appear in a configuration file. This syntax is extremely directive-specific, and is described in detail in the directive's definition. ... If the directive has a default value ( i.e. , if you omit it from your configuration entirely, the Apache Web server will behave as though you set it to a particular value), it is described here. ...

Еще в разделе: (Показать все результаты (>87) - neptun.sai.msu.ru/ )

• Module mod_cern_meta
• Apache module mod_mime_magic
• International Customized Server Error Messages

... - behave-, believe-, blurred-, body- border- both-; ... , ... bottom-, bursary- but-, , ; ; , calculate-, capable-, , carry-, ~ away - ~out- Cartesian- case-, cause-; cathode- centre- 4 certainly-, champion- (- ), , , change-, , characterise-() characteristic-, ... weight- whereas- while-, whole-, wide-, , width- witness-, wonder- no ~ - worth- to be ~ doing smth- - Y yield- Z zinc- 35 ...

Еще в разделе: (Показать все результаты (>21) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Model_rendering.pdf

On the Nature of Time © Giorgio Fontana April 2010 University of Trento Italy What is time and why it is so similar to the description of space dimensions in modern relativity theories and at the same time it looks so different to us? ... The fourth concept is that in Euclidean Relativity space everything travels at the speed of light; therefore the traditional concept of time is subs tituted by the concept of speed, specifically the speed of light. ...

Еще в разделе: (Показать все результаты (>552) - chronos.msu.ru/ )

• Ontology of the Universe
• Russian Interdisciplinary Temporology Seminar
• Laboratory-chair of Discrete mechanics on a microscopic scale

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... DRIVER: To develop a model of the interstellar hydrogen distribution in the heliosphere. To apply this model for the analysis of experimental data from different spacecraft. ... The results of the simulations of the formation and evolution of molecular clouds can be used as initial conditions for the current star formation in galaxies. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>35) - hpc.msu.ru/ )

• APPLICATIONS: Plasma Physics | Moscow University Supercomputing Center
• APPLICATIONS: Theoretical Physics | Moscow University Supercomputing Center

... 1) Ty velel, ctoby ja uekhal v Minsk odin, a Vasja by ostalsja s toboj? you ordered that-SUBJ I go to Minsk alone and Vasja BY remain with you `Did you order that I leave for Minsk alone and Vasja remain with you?' ... Notice that both the declarative complementizer cto and the subjunctive/modal complementizer ctoby are higher than left dislocated topics: (6) a. b. c. Ja dumaju cto on uekhal v Minsk odin. I think that he go to Minsk alone *Ja dumaju v Minsk cto on uekhal odin. ...

Еще в разделе: (Показать все результаты (>340) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/romanova.pdf
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/files/Coordination_Upper_Kuskokwim@Coordination_2004.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/kuznetsova.pdf

... 2, Moscow 123182, Russia Sergey V. Razin Institute of Gene Biology, RAS, Vavilova st. 34/5, Moscow 119334, Russia sergey.v.razin@usa.net In Drosophila, interphase chromosomes are organized in topologically associated domains (TADs) within which chromatin-chromatin interactions are frequent, while interactions across domain borders are rare [1]. ... Here we used Hi-C method [5] to map TADs in four drosophila cell lines of different origin. ... Cell 48:471­84. ...

Еще в разделе: (Показать все результаты (>224) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/115.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/56.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf

... Полная версия этой страницы: Из новостей - я кое-чего не понимаю [РЕШЕНО] . Студенческий форум Физфака МГУ > Наука физика > Есть проблема . ... 14.11.2008, 12:46 . Народ, помогите: вот пресс-релиз NASA про полярное сияние на Сатурне . ... Здесь "недоступный Хаблу участок" касается именно геометрии (северный полюс Сатурна не виден с Земли? ... И вот что интересно - я пока не нашел снимков северного полюса Сатурна с Земли (а твоя ссылка ведет как раз на снимок с орбиты вокруг Сатурна). ...

Еще в разделе: (Показать все результаты (>1171) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > A large IT company is looking for J2EE
• Студенческий форум Физфака МГУ > A large company is looking for Senior J2EE
• A large IT company is looking for J2EE Developer - Студенческий форум Физфака

... Toric Topology studies torus actions on manifolds and cell complexes whose orbit quotients have a rich combinatorial structure. ... Research proposal by T.Panov on toric topology for 2007-2009, supported by the grant of the Pierre Deligne Foundation of 2006: English summary , proposal (in Russian) . Research proposal by T.Panov on toric topology for 2011-2013, supported by the grant of the Dynasty Foundation of 2010: English summary , proposal (in Russian) . ...

Еще в разделе: (Показать все результаты (>130) - higeom.math.msu.su/ )

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

• Best search engines for finding scientific information in the Internet:

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>34) - observ.pereplet.ru/ )

... 1998 1 : Defended the Doctorate Degree Thesis on "Models of Cosmic Ray Particle Fluxes (Development and Applications)". ... Space Weather . ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv. ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv.Space Res. ...

Еще в разделе: (Показать все результаты (>9) - srd.sinp.msu.ru/ )

... Scientific goals . Cosmic rays of extremely high energy . ... Gamma-bursts . Magnetospheric particles and radiation conditions . ... The Earth?s atmosphere is ?a target? for different types of space radiation. ... In the atmosphere high energy particles produce cascades of the secondary particles ? ... Gamma-bursts also produce their ?response? in the atmosphere in the form of Сherenkov radiation. ... Studies of the described above phenomena is the main goal of the ?Lomonosov? satellite. ...

Еще в разделе: (Показать все результаты (>61) - lomonosov.sinp.msu.ru/ )

• Transient luminous events | Университетский спутник "Ломоносов"
• Mikhail Lomonosov ? the Pioneer of Russian Science | Университетский спутник
• Magnetospheric particles and radiation conditions | Университетский спутник

Thunderstorms and Elementary Particle Acceleration . ... Conference . The first announcement . ... The Thunderstorms and Elementary Particle Acceleration (TEPA-2012) conference is the second one devoted to the studies of the extreme atmospheric effects connected with amplification of electric fields in the lower atmosphere. ... TEPA-2012 conference will be held from July 9 till July 11, 2012, just after the 23rd European Cosmic Ray Symposium also organized by MSU ( http://ecrs2012.sinp.msu.ru ) . ...

Еще в разделе: (Показать все результаты (>2) - tepa2012.sinp.msu.ru/ )

babl: babl (pixel format translation library) babl: babl: babl is a dynamic, any to any, pixel format translation library. babl: babl: It allows converting between different methods of storing pixels known babl: as pixel formats that have with different bitdepths and other data babl: representations, color models and component permutations. babl: babl: A vocabulary to formulate new pixel formats from existing primitives is babl: provided as well as the framework to add new color models and data types. babl:

Еще в разделе: (Показать все результаты (>16379) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/skel.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc529.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc529.txt

Books Order images | ... Books | ... Printed out the book "Sea birds and mammals of Russian Far East" (illustrated field guide) written by bird's specialist Yuri Artukhin and sea mammals specialist Vladimir Burkanov. More then 300 photographs and paint arts, 200 maps. ... Alexander spent 8 years on an odyssey in a wild areas of Kamchatka that took him to record over a set of different species (such as Steller's sea eagle, swans, spawning salmons, bears, sea otters...) and their habitats. ...

Еще в разделе: (Показать все результаты (>154) - www.fadr.msu.ru/ )

• Abstracts
• the paleopedology working group had a conference last year in Mexico on "Global
• An International Consensus on Calcareous Paleosol Classification