... The subjects of the Colloquium-458 cover important problems dealing with the verification of constitutive equations, the organization of experiments, the connection between microstructures and mechanical properties and the effective utilization of the modern FEM packages. ... Institute of Mechanics, Lomonosov Moscow State University, Michurinsky Prospekt, 1, 117192, Moscow, Russia . ... S.-Petersburg, 195251, Russia. ... Institute for Problems in Mechanics of Russian Academy of Sciences . ...

Еще в разделе: (Показать все результаты (>3) - www.imec.msu.ru/ )

• EUROMECH Colloquium-458

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>646) - kodomo.cmm.msu.ru/ )

• Practice1(evolution)
• evolution
• Gene Evolution Reconstruction

Evolution of detonation propagation through an annular gap into a combustion chamber / N. N. Smirnov, V. F. Nikitin, Yu. ... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. ... Some results of theoretical studies of detonation processes in combustible gaseous mixtures are discussed for a model geometry of large combustion chambers of detonation engines in the case of mixtures of hydrogen and oxygen-enriched air. ... Key words : combustion, detonation, transition processes, engine. ...

Еще в разделе: (Показать все результаты (>105) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Правила
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

COMPUTER DESIGN OF HETEROCYCLIC RING-OPENING REACTIONS. ... Since the cleavage of ring bond requires appearance of new bond either between th e (endo) atoms of initial cycle, or between initial cycle and external (exo) group, the first case is treated as endoopening, and the another as exo-opening: Endo-Ring Opening Exo-Ring Opening © 1995 American Institute of Physics 75 7 758 Heterocyclic Ring-Opening Reactions General Methodology and Algorithms 1. ... RULE FOR ENDO-TYPE RJNG OPENING. ...

Еще в разделе: (Показать все результаты (>103) - www.chem.msu.ru/ )

... The Evolution of the Russian Tax System in the 19thcentury, . ... Ezhegodnik (Economic Hystory. ... 2002 , Moscow: ROSSPEN, 2003, p.345-383. ... The article deals with the history of the taxes of the Russian empire in the 19th century. ... Despite of the lag with the European model which consisted in the absence of income taxation, the Russian tax system had provided the budget with monetary resources, that were necessary for the financial stability of the Empire. ...

Еще в разделе: (Показать все результаты (>152) - hist.msu.ru/ )

• Project "The Labour Relations Evolution in Russian Industries"

Web-site : http://polly.phys.msu.su/seminar/vms/ 23 2002 . ... 1 2002 . ... Deadline for submission of abstracts Web-site: http://liquid.chem.uoa.gr International conference on: Colloid and Surface Technology; Fundamentals and Applications Lund, Sweden November 6th to 8th 2002. ... February 2003, Zurich, Switzerland Deadlines Abstract submission Camera ready manuscript May 31, 2002 October 31, 2002 Web-site: http://www.isfrs.ethz.ch " " 90- . ... Web site: http://www.icp.ac.ru/conference/EKS/ : - ., ...

Еще в разделе: (Показать все результаты (>197) - polly.phys.msu.ru/ )

• Seminar in Polymer Physics
• Publication list, Olga Shamardina

... Kandiano E. History of ice-rafting and water mass evolution at the northern Siberian continental margin (Laptev Sea) during Late Glacial and Holocene times // Quaternary Science Reviews, 2010, v.29 27-28. p. 3919-3935. ... Since seasonal sea ice cover is a permanent feature in this high Arctic region the prominent IRD-rich intervals in the oldest (>15.4 ka) and youngest (<7.2 ka) sediment units are attributed to iceberg-rafting. ... Correlation of the Late Holocene IRD peaks 5. ...

Еще в разделе: (Показать все результаты (>319) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/structure/labs/notl/personal/Abstracts/Taldenkova_ea_GloPlaCha_2005.pdf
• CONTENTS ? 1 - 2014
• Новый год новым годом

... K. Marx, F. Engels, Russia, Marxism, capitalism, Revolution, counterrevolution, feudalism, tsarism, russophobia . The article is devoted to the evolution of the analysis of the attitude of K. Marx and F. Engels to Russia. ... The author shows that their sights at Russia changed in connection with development of a situation in the world both in Russia and in connection with development of the marxist theory. ...

Еще в разделе: (Показать все результаты (>31) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2010/4/08.pdf
• http://www.socio.msu.ru/vestnik/archive/2011/1/11.pdf

Rare amino acid changes fixation drives divergence in Metazoa evolution K.V. Gunbin, V.V. Suslov, Y.L. Orlov Institute of Cytology and Genetics SB RAS, Novosibirsk, Russia , genkvg@gmail.com Novosibirsk State University, Novosibirsk, Russia One of the features of the molecular evolution of any amino acid sequence is an unevenness of the rates of mutation accumulation. ... Mutation bursts usually are accompanied by the fixation of statistically rare amino acid substitutions [2, 3]. ...

Еще в разделе: (Показать все результаты (>182) - mccmb.belozersky.msu.ru/ )

• MCCMB'15
• MCCMB'13

Lomonosov Moscow State University, Faculty of Mechanics and Mathematics, Department of the English Language Abstract Categorical Models of Quantum Mechanics By Alexander Zapryagaev, group 304 21 October 2014 The report deals with the axiomatic approach to the phenomena of quantum computation and algorithms. ... Finally, the logic behind quantum operations is discussed: it is revealed that the ideas of quantum algorithms have a strong connection to Jean-Yves Girard's linear logic. ...

Еще в разделе: (Показать все результаты (>23) - www.eng.math.msu.su/ )

Audio Engineering Society Convention Paper Presented at the 127th Convention 2009 October 9­12 New York, NY, USA The papers at this Convention have been selected on the basis of a submitted abstract and extended precis that have been peer reviewed by at least two qualified anonymous reviewers. ... Additional papers may be obtained by sending request and remittance to Audio Engineering Society, 60 East 42nd Street, New York, New York 10165-2520, USA; also see www.aes.org. ...

Еще в разделе: (Показать все результаты (>399) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2008.AES.Lukin_Todd.Gaps.en.pdf

... Студенческая Астрономическая обсерватория ГАИШ . ... Структура ГАИШ : Отдел внегалактической астрономии : . ... For those really interested in galaxies, extragalactic astronomy or the aspects of cosmology we study, we can always find an interesting problem to work on. ... To make your work in the Group most effective, it would be useful to study the following courses read by our group members as well as the members of other groups in our and other institures. ... Student information . ...

Еще в разделе: (Показать все результаты (>22) - www.sai.msu.ru/ )

• Отдел внегалактической астрономии: ГАИШ Extra-galactic astronomy Group

... education . ... Composite materials . Materials for solar and fuel cells . ... Registration deadline is 30 April 2012. ... New deadline is 15 May 2012 . ... Registration fee should be paid before 10 June 2012. ... For information please contact Mrs. Olga Bogomolova: obogomol@gmail.com and Dr. Alexander Chertovich: chertov@polly.phys.msu.ru . ...

Еще в разделе: (Показать все результаты (>27) - nano.msu.ru/ )

... Полная версия этой страницы: PhD in Astrophysical Sciences, Princeton, USA . Студенческий форум Физфака МГУ > Физфак и учеба > Аспирантура . ... The Department of Astrophysical Sciences, Princeton University (USA), . ... and related sciences and carry out original research in observational . ... of Astrophysical Sciences at Princeton include the Apache Point . ... Members of the department have access to state-of-the-art . ... life in the Department see http://www.princeton.edu/astro/graduate/ . ...

Еще в разделе: (Показать все результаты (>321) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Прием в аспирантуру Принстонского Университета
• Прием в аспирантуру Принстонского Университета по специальности Астрофизика -
• PhD in Astrophysical Sciences, Princeton, USA - Студенческий форум Физфака МГУ

... Continental Lithosphere Beneath SE Brazil . ... CREST (Continental Rifts: Evolution, Structure and Tectonics) Project . Crust and Upper Mantle Structure of S. California . ... Surface wave dispersion and upper mantle structure beneath southern Germany . ... Tomographic P-wave velocity inversion for the crust and upper mantle structure beneath Alaska . ... Upper Mantle Velocity and Q Structure . ... Velocity structure and anisotropy of the crust and upper mantle in the Brooks Range, Alaska . ...

Еще в разделе: (Показать все результаты (>19) - sbmg.geol.msu.ru/ )

• Europrobe2

... It is shown that behavior of optical pulse relative to AML signal in stable generation region is sufficiently depends on AML frequency detuning: while forming, pulse can obtain 1ns delay and even more. ... It is noted that borders of stable generation region are asymmetric relative to AML frequency with constant pulse delay. Velocity of delay increasing is different for positive and negative AML frequency detuning. ...

Еще в разделе: (Показать все результаты (>317) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2014/Kimberg_Brandt_en.pdf
• Публикация
• International conference on Advanced Laser Technologies ALT'12

... In this paper, we discuss the category of proverb. ... The paper is devoted to the analysis of usage of Russian idioms in the modern Russian mass media. ... XIX , , , . ... XVIII . ... The paper is devoted to investigation of the most important semantic traits of the emotive idioms in Russian language of the XVIII­XIX-th c. : - ; -- . ... The paper is devoted to the results of the research of the language of the Russian proverbs and sayings of the first half of the 18-th c. . XVII -- XVIII . ...

Еще в разделе: (Показать все результаты (>309) - www.philol.msu.ru/ )

• MSU-LGCLL:: Curriculum Vitae of Anatoliy Anatolyevich Polikarpov
• Title: Russian Language Training via INTERNET. Internet-based educational
• MSCL-3 | Call for Papers

SPIE - The International Society for Optical Engineering Ukrainian and Russian Chapters First Announcement/Call for Papers The Seventh International Conference Correlation Optics The Sixth International Conference on Correlation Optics will be held in Chernivtsi , Ukraine on September 6-9, 2005 The purpose of the conference is to provide a discussion of novel approaches and advances connected with optical ... A list of preliminary prices for proposed hotels is given below. ...

Еще в разделе: (Показать все результаты (>197) - phys.msu.ru/ )

• http://phys.msu.su/upload/iblock/63a/ic-cmtp3%20First%20Circular1-2.pdf
• http://phys.msu.su/rus/news/latest/programme_lectures_MSU_Farle_2014.pdf
• http://phys.msu.su/rus/news/latest/Abstract_ter-avetisyan.pdf

Conference on 'Reflections on the atomic nucleus', 28.06.2015, Liverpool, UK. This meeting, see http://ns.ph.liv.ac.uk/Reflections2015 , will touch upon a few sub-topics of current interest in nuclear structure physics including aspects of nuclear collectivity, strengths, shell evolution and super-heavy elements as well as sessions devoted to nuclear astrophysics, fundamental physics and new experimental probes. ... The conference fee is ?100. ...

Еще в разделе: (Показать все результаты (>6) - www.msu.dubna.ru/ )

Educational Technology & Society 10(3) 2007 ISSN 1436-4522 : .. . ... 1995). . ... Education Technology & Society 9(1) 2006 pp. 422-427. [ .., 1993] . ... Education Technology & Society 5(1) 2002, pp 222-243. ... Brusilovsky P., 1995] Brusilovsky P. Intelligent learning environments for programming: The case for integration and adaptation // In: J. Greer (ed.) Proceedings of AI-ED'95, 7th World Conference on Artificial Intelligence in Education, Washington, DC, 16-19 August 1995, AACE, pp. ...

Еще в разделе: (Показать все результаты (>145) - www.psy.msu.ru/ )