SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>273) - monkey.belozersky.msu.ru/ )

• Inquiry information || Distances
• About this project
• Inquiry information || Parsimony algorithm

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>2) - physcontrol.phys.msu.ru/ )

• List All Categories

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>171) - tukachev.flogiston.ru/ )

• Category: Новости

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property ?existence? of the material point varies from ?the material point does not exist? to ?the material point exists? by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>369) - chronos.msu.ru/ )

• John Sanfey.The Qualia of Now : Key to a Fundamental Equation of Consciousnes
• Ontology of the Universe
• Determination analysis as a method for diagnostics of ecosystem condition

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>276) - higeom.math.msu.su/ )

... Robert Hermann Brookline, MA (Received November 22, 1999) der to illustrate the obvious progress, one can mention a variety of examples. ... In or- FYI Item "BMS Report on Institutes" As a member of the panel commissioned by the Board on Mathematical Sciences of the National Research Council, I write to correct several inaccuracies in the "For your information" note by Allyn Jackson entitled "BMS Report on Institutes" in the December 1999 issue of the Notices. ...

Еще в разделе: (Показать все результаты (>61) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/prokhorov/phd/phd.htm

New GCVS Version (GCVS5) FileName Explanations ----------------------------------------------------------------- ReadMe This file GCVS5 The ... ------------------------------------------------------ 1- 2 I2 --- Constell [1/88]Constellation numeric code 3- 6 I4 --- Number Star number within the constellation 7 A1 --- Component *Component identification 9- 18 A10 --- GCVS * Variable ... Field is non-blank if magMin is a magnitude or amplitude given in a system other than that indicated by magCode. ...

Еще в разделе: (Показать все результаты (>86) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Description
• Презентация PowerPoint
• General Catalogue of Variable Stars: Vols I-III (the new electronic version).

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>18) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Gracheva.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

Download FDSL 7.5 flyer ! home . ... The 7.5th European Conference on Formal Description of Slavic Languages, Moscow, December 6 8, 2008 . The European Conference on Formal Description of Slavic Languages was first held in 1995 at the University of Leipzig. Up till 2006, the biannual FDSL was hosted in turn by the University of Leipzig and Potsdam University. ... December 6 8, 2008 . ... FDSL 7.5 (halftime) will be held on December 6 8, 2008 at the Independent University of Moscow. ...

Еще в разделе: (Показать все результаты (>305) - www.philol.msu.ru/ )

• LangueDOC :: Archi :: Alphabet

... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>129) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2009/suprun.pdf

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

• Index of /about_center/workplaces

... E. Huhlaev, Metamake Tools for Personal Project Preparation in Heterogeneous Network Environment (ID=260), Word doc . ... O. Kodolova, Experience with OO Database for CMS Events Distributed Between Two Sites (ID=294), PDF file . ... A. Nikitin, The GA Based Approach to Optimization of Parallel Calculations in Large Physics Problems (ID=220), Word doc . ... J. Seixas, Neural Particle Discrimination for Triggering Interesting Physics Channels Using Calorimetry Data (ID=311), PDF file . ...

Еще в разделе: (Показать все результаты (>64) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/ososkov/ACATOsoskov.doc
• http://acat02.sinp.msu.ru/presentations/tyupikova/doclad.doc
• http://acat02.sinp.msu.ru/presentations/vaiciulis/acat2002.ps

... Manuscripts submitted to the journal should be divided into the following sections: Title page, Abstract (in Russian and English), Key words (in Russian and English), main manuscript text, list of references, tables, figures and figure captions. ... Full size of the article includes list of references, tables and figures. ... Rich text format (*.rtf) . ... References are given in the text in square brackets; full references are given at the end of the manuscript in the section List of references. ...

Еще в разделе: (Показать все результаты (>25) - www.anthropos.msu.ru/ )

... Physics Department . ... Home :: Directions of Research :: General Approaches to Statistical Thermodynamics of Copolymers of Practical Importance (theory) Phase diagrams of solutions, melts and blends consisting of copolymers obtained during realistic polymerization processes. ... Miscibility Maps and Blends Containing Statistical Copolymers. ... Home :: Directions of Research :: General Approaches to Statistical Thermodynamics of Copolymers of Practical Importance (theory) . ...

Еще в разделе: (Показать все результаты (>211) - polly.phys.msu.ru/ )

• Science
• Teaching
• Microphase Separation, Formation of Other Microstructures in Polymer Systems -

Announcement On November 2-3, 2005 Lomonosov Moscow State University will conduct jointly with the Academy of Cryptography of the Russian Federation the Fourth All- Russian Conference Mathematics and Security of Information Technologies [Cybersecurity?] and jointly with the Center of International Studies, Cambridge University , United Kingdom, Advanced Research Workshop Unconventional ... Sherstyuk V.P. - Security Council of the Russian Federation; 3. ... Organization Committee 1. ...

Еще в разделе: (Показать все результаты (>9) - suny.msu.ru/ )

• http://suny.msu.ru/ru/ProgramMaBIT05En.doc
• Center on Russia and the United States :: Summary of SUNY/MSU Center Activities

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

78. Manuscript guidelines

79. Abstract

80. http://nanofluidics.phys.msu.ru/paper/JCP2014-2.pdf