Маломассивная тесная рентгеновская двойная - это звездная система, где аккретором является нейтронная звезда или черная дыра, а донором - маломассивная нормальная звезда. ... В массивных двойных системах источником вещества обычно является звездный ветер. ... Часто аккреционный диск не образуется: вещество квазисферически падает на компактный объект. ... Обычно масса звезды-донора больше 10 масс Солнца. ... Вещество с маломассивной звезды претекает на компактный объект, образуя т.н. аккреционный диск. ...

Еще в разделе: (Показать все результаты (>66) - xray.sai.msu.ru/ )

• AXAF-Chandra
• PROBLEMS OF THEORETICAL COSMOLOGY - UISS2000
• Table of Contents of Zombeck's Handbook of Space Astronomy and Astrophysics

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ґ computer related 1) Ї Perform simulation , create trajectory file Ї Calculate properties timestep by timestep 2) Ї Perform ...

Еще в разделе: (Показать все результаты (>4) - www.elch.chem.msu.ru/ )

• Molecular aspects of solid state and interfacial electrochemistry

Home QFTHEP'2013 Participants . ... Preliminary list of participants . ... Organization (Institution) . ... Saint Petersburg State University . ... SINP MSU . ... Saint-Petersburg State University, Faculty of Physics . ... Institute for Nuclear Research . ... Skobeltsyn Institute of Nuclear Physics, M.V. Lomonosov Moscow State University . ... SINP Moscow State University . ... Skobeltsyn Institute of Nuclear Physics of Moscow State University . ... D.V. Skobeltsyn Institute of Nuclear Physics, MSU . ...

Еще в разделе: (Показать все результаты (>33) - qfthep.sinp.msu.ru/ )

• QFTHEP'2015 Plenary Talks
• June 25, 2015
• June 27, 2015

Wireshark Ї Ї Ї Ї Ї (Win, Mac, Linux) Open Source (http://www.wireshark.org) Ї Ї Ї ( ) Ї 2 1 Ї # usermod ґa ґG wireshark user Ї wireshark root user@host:~$telnet ya.ru 80 Trying 213.180.193.3.. ... MAC 2. MAC IP ARP 3. L4 Interface # 1 2 3 4 Domain # 1 1 Eth Address 00:00:00:00:00:0a 00:00:00:00:00:09 IPv4 Address 10.0.1.2 10.0.1.1 10.0.2.2 10.0.0.3 Flow # 1 2 Src Itf # 1:49153 3:49153 Dst Itf # 4:234 1:432 Protocol TCP UDP Edges 1-2 1-2 .. ...

Еще в разделе: (Показать все результаты (>2) - lvk.cs.msu.su/ )

Topology section consists of 5 plenary talks (by Alexandr Gaifullin, Mikiya Masuda, Serguei Novikov, Charles Pugh, and Nigel Ray) and 3 special sessions: . ... Talks within Topology Section are scheduled on Wednesday, Thursday, and Saturday afternoons and include 30-min and 20-min invited and 20-min contributed presentations. ... Combinatorial and Toric Topology , room 12-13 . ... Arkadiy Skopenkov (MSU, Moscow). ... Inst., ... Natalya Mozhey (State Technological Univ., ... USA); invited speaker . ...

Еще в разделе: (Показать все результаты (>22) - higeom.math.msu.su/ )

e-mail: lbronzino@gmail.com) , , " ", , " ", , , personal knowledge, tacit knowledge, "knowledge archaeology", subjectivity, "tacit knowledge", social cognition, methodology " " . ... According to M. Foucault, the "archive creation" may emerge as the missing element which can make up for the model of social cognition in which tacit knowledge will be expressed whereas Foucault integrates different practice patterns ґ first and foremost, knowledge and power ґ to create "knowledge archaeology". ...

Еще в разделе: (Показать все результаты (>2) - vestnik.socio.msu.ru/ )

Аномалии полового развития амфипод Gammarus pulex (L.), найденных ниже станции для очистки сточных вод. ... С. 1792-1797. ... У самцов амфипод, обитающих ниже очистных сооружений в графстве Суррей (Великобритания), строение гонад, наружные половые признаки и размеры тела были такими же, как на контрольном участке. У самок значительно нарушалась структура ооцитов в вителлоегенезе. Одновременно уменьшалась длина тела самок и отношения размера самцов к размеру самок по сравнению с контролем. ...

Еще в разделе: (Показать все результаты (>3) - ecoinformatica.srcc.msu.ru/ )

... Academic Departments . ... Partners . ... All partners . ... 02.12.2013 . Andrei Richter "The notion of freedom of (the media) in international law and policy" . ... Hannu Nieminen "Changes in the Regulatory Framework of Media and Communications: Four Explanatory Strategies and Six Researcher Profiles" . ... Awarding the titles of Honorary Professors of the Faculty of Journalism, Lomonosov Moscow State University: . ... 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>4) - www.journ.msu.ru/ )

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>3832) - kodomo.fbb.msu.ru/ )

Proteogenomic analysis of bacterial signal peptides Dmitry N. Ivankov1, Samuel H. Payne2, Stefano Bonissone3, Si Wu4, Roslyn N. Brown2, Ljiljana Pasa-Toli4, Matthias Birschenk5, Iris ... Department of Genome-Oriented Bioinformatics, Technische UniversitДt MЭnchen, Freising, Biological Sciences Division, Pacific Northwest National Laboratory, Richland, WA, USA ; Bioinformatics Program, University of California San Diego, La Jolla, CA, ... 2013) How many signal peptides are there in bacteria? ...

Еще в разделе: (Показать все результаты (>31) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/134.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/4.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/120.pdf

. Here you can find friends. _:_ .. Vital and Michael . Andrew A. Martis . Sania Berezin (in Reebok) and Piter Bogdanovskiy image . Sergey Popov : home page. Andrew Lobanov : home page. Andrey Kravtsov : home page. Happy birthday to you , Max ! .

Еще в разделе: (Показать все результаты (>22) - comet.sai.msu.ru/ )

• Examples of using the telnet command
• Strange House

. Posted by Michael J. Singer 17 Sen 2003 11:19:03 . Hello All, . I just returned from the Polish soil Science meetings in Krakow where . I met with Don Sparks, Professor Blume and others about the . paleopedology issue. We agree that IUSS is an appropriate venue for . a paleopedology commission and we will push for this at the meeting . in April in Philadelphia. I see a bright future for paleopedology . within IUSS. All the best, . Mike .

Еще в разделе: (Показать все результаты (>42) - www.fadr.msu.ru/ )

• http://www.paleopedology.msu.ru/discussions/messages/202.html
• Abstracts
• LOESS IN ARGENTINA: TEMPERATE AND TROPICAL (Report on the International Joint

Moscow 2013 16th Lomonosov Conference Particle Accretion onto Miniholes Michael L. Fil'chenkov Yuri P. Laptev Institute of Gravitation and Cosmology, Peoples' Friendship University of Russia, Moscow 1 Moscow 2013 16th Lomonosov Conference Outline Ї Introduction Ї Classical Accretion onto Black Holes Ї Quantum Hydrodynamics Ї Quantum Accretion on The total luminosity of the accretion disc and the energy of quanta being emitted have been calculated. ...

Еще в разделе: (Показать все результаты (>47) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Fil'chenkov.pdf

... IUPAB) 28 ґ 2 2007, . IUPAB -. Ian C.P. Smith Ian C.P. Smith () () Henrik Flyvbjerg () () () () () () Joe Tien () () () () Erik Mosekilde () Leonardo Masotti () Michael Andre () () John Connally () ( ) () () Aaron Fenster () () Latchezar Avramov () Sylwester Sommer () Andrzej Wojcik () Stanislav Kozubek () Radostina Georgieva () 800. : ґ 1 2007, ґ 28 2007 http://www.msm.biophys.msu.ru dubna2007@biophys.msu.ru . 939-19-66 ...

Еще в разделе: (Показать все результаты (>4) - www.msm.biophys.msu.ru/ )

Head of the project: . ... Deputy head on the scientific program: . ... Head of the "Space Laboratory Work" . ... Postal address: Leninskie Gory, SINP MSU, Moscow, 119992, Russia, project "MSU-250" . ...

Еще в разделе: (Показать все результаты (>9) - cosmos.msu.ru/ )

... Add the jqWikiWord to an html input field and specify the source from which to derive the WikiWord using metadata of the following format: { source:'selector', /* e.g. '#projectTitle' */ initial:'initial value', /* e.g. 'Project...' */ prefix:'string to be prefixed to the wiki word', /* e.g. 'Project' */ suffix:'string to be appended to the wiki word' /* e.g. 'AUTOINC0' */ } . ... This topic: System > JQueryPlugin > JQueryWikiWord . ... Copyright by the contributing authors. ...

Еще в разделе: (Показать все результаты (>1175) - wiki.cs.msu.ru/ )

• JQueryLoader < System < Foswiki

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>10) - neptun.sai.msu.ru/ )

• Apache module mod_log_referer

Laboratory of Microfluidics and Nanofluidics . Laboratory of Physical Chemistry of Modified Surfaces . ... Russian Academy of Sciences . ... Martin Z. Bazant , MIT, USA . Lyderic Bocquet , Univ. Lyon, France . Francois Feuillebois, ESPCI, France . Jens Harting , Univ. ... Martin Moller , RWTH Univ. Aachen, Germany . Friederike Schmid , Univ. Mainz, Germany . Gleb B. Sukhorukov , Univ. ... Fathollah Varnik , Univ. ... Matthias Wessling , RWTH Univ. ...

Еще в разделе: (Показать все результаты (>8) - nanofluidics.phys.msu.ru/ )

You can search database for submitted information. ... Character * specifies arbitrary character sequence (eg. '*n' will result: John, Martin etc.) Character * is placed at end of line automatically ('Mar*' = 'Mar' will result: Martin, Martina etc.) Blank form will result ALL database records. ... Family name: . ... Topic: . ... Seismo-tectonics of Tsunami 3. Numerical and Analytical Models of Local Tsunami Behavior 4. ... Recent Local Tsunamis 8. ... Information . ... Database search . ...

Еще в разделе: (Показать все результаты (>4) - seac47-2.phys.msu.ru/ )

... Sincer ely, Michael D. Intriligator Michael D. Intriligator Professor of Economics, Political Science, and Policy Studies, UCLA Senior Fellow, the Milken Institute Telephone: 310-825-4144; Fax: 310-825-9528 E-mail: intriligator@econ.ucla.edu My brief biography follows. ... Dr. Intriligator is Vice Chair and a member of the Board of Dir ectors of Economists for Peace and S ecurity (EPS) and was President of the P eace Science Societ y (Inter national) in 1993. ...

Еще в разделе: (Показать все результаты (>5) - www.mse-msu.ru/ )