Faculty of Global Studies, Lomonosov Moscow State Uiversity Information Sheet 2014- 2015 GENERAL INFORMATION University Website Faculty Website for Exchange Students Academic Guide for Exchange Students Mailing Address of the Faculty (for courier delivery as well) Contact Information of the international department of the Faculty http://www.msu.ru/ http://fgp.msu.ru/ http://fgp.msu.ru/ru/ ... The faculty provides exchange students with the dormitory. ...

Еще в разделе: (Показать все результаты (>39) - fgp.msu.ru/ )

... file but would like it to be automatically updated # again, run the following command: # sudo dpkg-reconfigure -phigh xserver-xorg Section Files EndSection Section InputDevice Identifier Generic Keyboard Driver kbd Option CoreKeyboard Option XkbRules xorg Option XkbModel pc105 Option XkbLayout us ...

Еще в разделе: (Показать все результаты (>28) - observ.pereplet.ru/ )

• MASTER GLOBAL ROBOTIC TELESCOPES NET

Indarctos punjabiensis atticus (Carnivora, Ursidae) in Ukraine with survey of Indarctos . Late Miocene Indarctos punjabiensis atticus (Carnivora, Ursidae) in Ukraine with survey of Indarctos records from the former USSR . ... The detailed description of the latest Miocene (MN 13) maxillary fragment with P4-M2 of Indarctos bear from Ananiev in the southern Ukraine is given. ... The Indarctos records from the territory of the former USSR are reviewed. ... Miocene Land Mammals of Europe. ...

Еще в разделе: (Показать все результаты (>815) - zmmu.msu.ru/ )

• Far-Eastern grey voles (Rodentia: Cricetidae: Alexandromys) from Bolshoi
• Russian Journal of Theriology
• Uropatagium venation pattern in bats as diagnostic character (by the example of

... Emanuel Institute of Biochemical Physics RAS, Moscow, Russia The ultrahigh-resolution Fourier transform ion cyclotron resonance ( FTICR ) mass spectrum of natural organic matter (NOM) contains several thousand peaks with dozens of molecules matching the same nominal mass Such a complexity poses a significant challenge for automatic data interpretation, in which the most difficult task is molecular formula assignment, especially in the case of heavy and/or multielement ions. ...

Еще в разделе: (Показать все результаты (>92) - mgumus.chem.msu.ru/ )

• Seminar 11 December 2002
• Seminar 19 December 2002

Fluid and melt inclusions in minerals of West Greenland lamprophyres . ... The lamprophyres are massive dark gray rock with no less than 50% olivine phenocrysts ( mg up to 0.9) and less abundant laths of phlogopite, ilmenite, and Cr spinel embedded in an altered fine-grained groundmass of carbonate-dominated composition. ... Irrespective of the origin, the olivine grains are strongly altered; however, there are relics of fresh olivine containing melt inclusions. ... Primary melt inclusion in olivine. ...

Еще в разделе: (Показать все результаты (>283) - geo.web.ru/ )

• http://geo.web.ru/~ariskin/docs/papers/p96_037.pdf

... Kirill Laptinsky was born on June 21, 1991 in Moscow. In 2008, he graduated from Moscow physico-mathematical lycee No. 1568 and entered Physics Department of M.V.Lomonosov Moscow State University. ... His yearly project at the second course was devoted to solution of inverse problems of Raman spectroscopy of water media using artificial neural networks. ... Exploring Quantum Physics . ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>23) - rswater.phys.msu.ru/ )

• Kirill Laptinsky

... Описание вакансии: . В международную химическую компанию требуется "Аналитик-исследователь". Job overview: The research analyst conducts non routine/non-standard analytical research to provide analytical services to Process Technology Development . ... Conducts analytical research on assigned research projects; . Performs analyses in support of PT research projects; . Develops analytical methods; . Advises in analytical problems/challenges; . ... Minimum qualifications: . ...

Еще в разделе: (Показать все результаты (>5) - www.chemport.ru/ )

• Real estate market in december маркетинговые исследования мирового рынка новых

... Custom Query . ... Component . ... automata io requirements ui . ... В And В Blocked By Blocking Cc Component Created Description Keywords Milestone Modified Owner Priority Reporter Resolution Status Summary Ticket Type . Or В Blocked By Blocking Cc Component Created Description Keywords Milestone Modified Owner Priority Reporter Resolution Status Summary Ticket Type . ... Summary Component Milestone Status Owner Type Priority Resolution Created Modified Blocked By Blocking Reporter Keywords Cc . ...

Еще в разделе: (Показать все результаты (>391) - kodomo.cmm.msu.su/ )

• Custom Query ? Cyclyc Cell Automata

... THEORETICAL BASES AND EXPERIMENTAL ANALYSIS OF SOIL SOLUTION TRANSFORMATION UNDER INDUSTRIAL POLLUTION AND REHABILITATION OF SOILS . ... Transformation of soils solutions under air pollution impact. ... Prediction of soil solution changes in response to soil contamination and rehabilitation with dynamic bigeochemical models. The project aims to study, both theoretically and experimentally, response of soil solutions to contamination/remediation of soils by/from heavy metals. ...

Еще в разделе: (Показать все результаты (>26) - eco.soil.msu.ru/ )

• LONG-TERM RESPONSE OF FOREST SOILS TO ACID DEPOSITION
• THEORETICAL PRINCIPLES AND METHODS OF REMEDIATION OF SOILS POLLUTED WITH HEAVY
• Koptsik G.N., et al. Response of pine forests to long-term air pollution at the

... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>135) - www.psy.msu.ru/ )

... Институт . ... Студентам . Приветствуем вас на Официальном сайте Русско-германского института науки и культуры. Published by admin on April 6, 2016 under Новости . ... No Comments ? ... 09.00 - 15.30 љ љљ 736 - 1.ГУМ . ... Морозова Е.Б. пн. љ17-00? 18-30, 18-45?20-15, 20-30?21-15љ 1 к., ауд.736 1 ГУМ . ... Башкиров В. М. вторник 15.00-17.00, четверг љ15.00-17.00, 1 ГУМ ауд.736 . вторник 17.00-19.00, пятница 17.00-19.00 1 ГУМ ауд.736 . ... 736 1 Гум) . ... 7361 Гум) . ... December 2011 . ...

Еще в разделе: (Показать все результаты (>2) - rgi.msu.ru/ )

Proposals and projects in the Coordinated Call FP7-ICT-2011-EU- Russia Information Meeting Moscow: 21st October, 2010 EU- Russia Call · First ICT Joint Call with Russia (dedicated INCO Call in WP 11-12); joint calls have already been implemented in other areas of FP7 · Russia is investing in High Performance Computing: No 12 supercomputer in the top500 list is Russian; aiming to enter Top3 already in ...

Еще в разделе: (Показать все результаты (>34) - www.msu.ru/ )

... Like ordinary make, metamake keeps platform-dependent files (object, executables, libraries) for repeated usage. To use the metamake, one must define basic project directories (task directory, target root, object directory etc) and prepare two simple files: task-file that contains common project settings (selected compilers, common system libraries etc) and architecture- independent Imake-file which includes project description along with compiler and linker directives. ...

Еще в разделе: (Показать все результаты (>54) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/brun/Exercises_2.doc
• http://acat02.sinp.msu.ru/presentations/brun/Solutions_2.doc
• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-07-DataManagement1.pdf

... MI RAN, Alexeyev Conference, 23-28 December . MODERN THEORY OF DYNAMICAL SYSTEMS AND APPLICATIONS TO THEORETICAL CELESTIAL MECHANICS . ... Moscow, December 23-28 . ... SECTION A mostly includes talks in celestial and Hamiltoinian mechanics, symplectic geometry, and some other topics. ... MORNING SESSION 9:30-10:20 . ... BREAK . 12:00-12:50 . SECTION A . ... Special session: SCIENTIFIC LEGACY OF V.M.ALEXEYEV . ... On the works of V.M. Alexeyev in celestial mechanics and dynamical systems. ...

Еще в разделе: (Показать все результаты (>81) - www.mmonline.ru/ )

• MMOnline | Новости | MI RAN, Alexeyev Conference, 23-28 December

... All circuit parameters have been presented in a symbolic form. ... To use the program you will need a CIR file (PSpise, DesignLab file) of your circuit. CIR file examples have been enclosured: bpasside.cir, test1.cir, test2.cir, test3.cir, test4.cir, laksamp.cir, bridge.cir, uA741acf.cir, quartz.cir. ... Ideal operational amplifier (nullor) * Nname n1 n2 n3 n4 * * In the ideal op amp data, (n1,n2) represent output nodes, * (n3,n4) represent input nodes (noninverting, inverting). ...

Еще в разделе: (Показать все результаты (>9) - astrometric.sai.msu.ru/ )

• Complex evaluator
• Symbolic matrix processor

... The present report contains recommendat ions for tempo parameters control obtained for the Russian language as a result of special experiments including both the acoustic analysis o f a representative speech material (about 1 hour of duration) and the study of percept ion of tempo contrasts by Russian nat ive speakers. ... Some characterist ics of Russian speech depending on different tempo of pronunciat ion // Hearing and Speech in the norm and patho logy. ... Speech: Articulation and Perception. ...

Еще в разделе: (Показать все результаты (>238) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.doc
• FDSL-7.5 | Home

... In this paper we present a technique for authorship attribution based on a simple Markov chain of letters (i.e., just letter bigrams are used). ... We show that this technique provides excellent results when applied to over 380 texts from the Project Gutenberg archives, as well as to two previously published data sets. ... They examine the proportion of function words used by an author, and find that this is stable for each author, across a large number of writers in Russian. ... One Text . ...

Еще в разделе: (Показать все результаты (>35) - old.philol.msu.ru/ )

• Using Literal and Grammatical Statistics\\ for Authorship Attribution
• MSU-LGCLL:: O.V. Kukushkina, A.A. Polikarpov, D.V. Khmelev - Authorship

... A new environmental -economic policy Low environmental financing Boris Gryzlov: the ruling party on environmental problems Sociological survey of the state of environment in Russia The outcome of Rosprirodnadzor in 2010 Environmental policy in the Northwest Federal District Fundamentals of Ecological Policy of ... Environmental policy in the Northwest Federal District Heads of territorial bodies of Rosprirodnadzor in the Northwest Federal District summed up for 2010. ...

Еще в разделе: (Показать все результаты (>256) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/oby/Geoarchaeology_2012_1st_Circular.pdf
• http://www.geogr.msu.ru/science/projects/our/ross_swed/NewsLETTER/2_11.pdf
• http://www.geogr.msu.ru/structure/labs/geos/personal/LANTUIt2012.pdf

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>499) - monkey.belozersky.msu.ru/ )

• SDPpred
• SCOP famyli:
• SCOP classification

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )