... Microstructure deeply influences the properties and thus the functionality of a material. In an X-ray diffraction pattern, the microstructure information is usually extracted from the breadth and shape of line profiles. ... Доклад ?Structure/microstructure and their interplay in nanomaterials and layered systems? оказался очень полезным и интересным для ученых, работающих в области неорганического синтеза и физико-химических методов исследования. ...

Еще в разделе: (Показать все результаты (>21) - nano.msu.ru/ )

• Fundamentals of Nanotechnology, 2009 | MSU Nanotechnology Education and
• Fundamentals of Nanotechnology, 2009 | Научно-образовательный центр по

... Hamiltonian Systems and the Generation of Vortex Structures in Fluid Motion . ... It followes in this case that there exists the coordinate system such that the evolution of two of the coordinates is governed by a time-dependent Hamyltonian system with the evolution of remaining coordinate being governed by a first order differential equation that depends only on the other two coordinates and time. ... The process of arising, evolution and disappearance of the vortex structures is described. ...

Еще в разделе: (Показать все результаты (>221) - acs366.phys.msu.su/ )

• Schedule : Nonlinearity of Media and Structures, Nonlinear Testing
• Nonlinearity of Media and Structures, Nonlinear Testing
• Abstract (Invited)

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Active Directory смена пароля . ... Re: Active Directory смена пароля [ re: Shurik ] . ... возвращаясь к смене пароля . ... Re: Active Directory смена пароля [ re: ykpon ] . ...

Еще в разделе: (Показать все результаты (>33204) - www.fds-net.ru/ )

• что лучше Active Directory или Novell eDirectory? - Public forum of MSU united
• Проблема с Х-ами при загрузке - Public forum of MSU united student networks
• [News] Научное программное обеспечение - Public forum of MSU united student

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>222) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Structure
• SAI OCL Catalog Publications
• SAI Open Star Clusters (SAI OCL) Catalog

... Home :: Directions of Research :: Sequence Design of Copolymers with Special Functional Properties Conformation-dependent sequence design (engineering) of AB-copolymers. ... Experimental realizations of synthetic copolymers with sequence design. ... Biomimetic Sequence Design in Functional Copolymers. ... Functional Copolymer Macromolecules: Design, Characterization and Properties. ... Home :: Directions of Research :: Sequence Design of Copolymers with Special Functional Properties . ...

Еще в разделе: (Показать все результаты (>317) - polly.phys.msu.ru/ )

• SHORT ANNOTATION AND MAIN RESULT
• Selected publications of Ivanov, Viktor Alexandrovich
• Selected publications of Chertovich, Alexander Viktorovich

... Географии мирового хозяйства . ... Выберите кафедру . ... Кафедры . ... Учебно-научные базы . ... РЖ "Вестник МГУ", сер." ... РЖ "Geography, Environment, Sustainability" . ... Учебно-методический отдел . ... Кафедра географии мирового хозяйства . Кафедра геохимии ландшафтов и географии почв . ... Кафедра социально-экономической географии зарубежных стран . ... НИЛ возобновляемых источников энергии . ... Редакция журнала "Geography, Environment,... journal GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY . ...

Еще в разделе: (Показать все результаты (>393) - www.geogr.msu.ru/ )

• Сергей Сергеевич Зилитинкевич
• Вестник Московского университета. Серия 5. География
• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>83) - textbook.sinp.msu.ru/ )

... Роджер Пэнг (љ Roger Peng) на своем youtube-канале выложил видео 4х недель своего курса ?Computing for Data Analysis? Week 1 : . ... Data Types . ... Reading/Writing Data: Part 1 . ... The ?str? function . ... Writing Functions . ... The mapply function in R . ... Using the apply function in R . ... Plotting (base graphics) . ... Plotting with lattice . ... IBM SPSS Statistics 20 и AMOS: профессиональный статистический анализ данных Самые важные научные исследования последнего десятилетия. ...

Еще в разделе: (Показать все результаты (>61) - tukachev.flogiston.ru/ )

• Statistics One, Lecture 3, example script
• Category: Новости

... Academic . ... Academic Departments . ... Partners . Conferences . ... All partners . ... The international academic conference . ETHNIC PRESS GENESIS, STRUCTURE, DEVELOPMENT TRENDS . ... Conference proceedings will be published at the endљ . of the Conference as a collection of scientific articles and available in electronicљ . ... Organizing Committee address: Department of Journalism, Room 325 A, 3d floor, Main Academic Building, 42 Kulakovskogo St., Yakutsk, 677000. ...

Еще в разделе: (Показать все результаты (>42) - www.journ.msu.ru/ )

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ­ computer related 1) · Perform simulation , create trajectory file · Calculate properties timestep by timestep 2) · Perform ...

Еще в разделе: (Показать все результаты (>22) - www.elch.chem.msu.ru/ )

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>21) - observ.pereplet.ru/ )

... Parent Directory - Thumbs.db 01-Nov-2010 03:25 8.0K _vti_cnf/ 01-Nov-2010 03:25 - _x_todo.htm 01-Nov-2010 03:25 555 _x_todoh.htm 01-Nov-2010 03:25 557 botinfs.cnf 01-Nov-2010 03:25 146 bots.cnf 01-Nov-2010 03:25 323 deptodoc.btr 01-Nov-2010 03:25 324 doctodep.btr 01-Nov-2010 03:25 114K fpdbw.ico 01-Nov-2010 03:25 1.1K linkinfo.btr 01-Nov-2010 03:25 23K service.cnf 01-Nov-2010 03:25 1.3K service.lck ...

Еще в разделе: (Показать все результаты (>158) - genphys.phys.msu.su/ )

• Index of /rus/edu/kvant/II_2/STAT2/_vti_pvt
• Index of /ol/2002

The morphological character of earth material in soil profiles is popularly known as soil structure. ... However, descriptions and useful interpretations of soil structure can be made at any scale or "level of organization" (Brewer, 1964) . ... After a long search for a name that would avoid confusion with other contexts, I chose the term klumpen for this class and treated it as one level of soil structure. ... Soil structure and fabric: their definition and description. ...

Еще в разделе: (Показать все результаты (>172) - www.fadr.msu.ru/ )

• THE POST-SIMPOSIUM EXCURSION (July 31 - August 7,1998)
• REPORT ON INTERNATIONAL SOIL SCIENCE CONGRESS (Montpellier, France, August...

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>16) - optics.sinp.msu.ru/ )

• polist99
• zagedan

... Data . ... Solar energetic particles . ... Solar flare database (RU) . ... Select the storm date: . Select storm intensity threshold: . ... Developed in 2007. Copyright €й 2007 - 2016 Skobeltsyn Institute of Nuclear Physics Moscow State University Feedback ...

Еще в разделе: (Показать все результаты (>21) - smdc.sinp.msu.ru/ )

• Space monitoring data center

Wireshark · · · · · (Win, Mac, Linux) Open Source (http://www.wireshark.org) · · · ( ) · 2 1 · # usermod ­a ­G wireshark user · wireshark root user@host:~$telnet ya.ru 80 Trying 213.180.193.3.. ... MAC 2. MAC IP ARP 3. L4 Interface # 1 2 3 4 Domain # 1 1 Eth Address 00:00:00:00:00:0a 00:00:00:00:00:09 IPv4 Address 10.0.1.2 10.0.1.1 10.0.2.2 10.0.0.3 Flow # 1 2 Src Itf # 1:49153 3:49153 Dst Itf # 4:234 1:432 Protocol TCP UDP Edges 1-2 1-2 .. ...

Еще в разделе: (Показать все результаты (>7) - lvk.cs.msu.su/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Next: DSP board program Up: SPM Installation Previous: Mechanical system of the Contents Index . Figure 1.3: Software structure. The server part of the software is working under Windows NT or XP operating systems. ... Second level - operating system driver, that allow to exchange data with DSP board through input/output ports. ... This structure is a result of qualities this system should satisfy: precise process synchronization, hi-speed data transfer, network support, convenience in usage. ...

Еще в разделе: (Показать все результаты (>108) - www.spm.genebee.msu.ru/ )

• Slide Show
• Message window
• THE STRUCTURE AND PROPERTIES OF MONOMOLECULAR FILMS BASED ON

Astronomy Picture of the Day . ... 15.08.2003 . ... Credit: Malin Space Science Systems , MGS , JPL , NASA Explanation: High-resolution imaging of an area in the Schiaparelli Basin of Mars on June 3 by the MGS Mars Orbiter camera produced this stunning example of layered formations within an old impact crater. ... August . ... August 2003 . ... Publications with keywords: Mars - crater - sedimentary rock . Publications with words: Mars - crater - sedimentary rock . ... Victoria Crater on Mars . ...

Еще в разделе: (Показать все результаты (>8912) - www.astronet.ru/ )

• Solar Surfin
• Астронет > Solar Surfin
• Journal "Peremennye Zvezdy"

... Глебов О. О. Получение пропептидов секреторных протеиназ бактерий методом гетерологичной экспрессии в Escherichia coli . ... Серкина А.В. Предшественники бактериальных секреторных протеиназ: получение и характеристика. ... Ikemura H., Takagi H., Inouye M.Requirement of Pro-sequence for the Production of Active Subtilisin E in Escherichia coli.. ...

Еще в разделе: (Показать все результаты (>363) - www.nature.web.ru/ )

• Инициация трансляции у эукариот
• Протеолитический процессинг у синдбис-подобных вирусов