Atmospheric transparency in the optical and near IR range above the Shatdzhatmaz summit O.Voziakova (Sternberg Astronomical Institute, Russia) Atmospheric extinction in the MASS spectral band Atmospheric transparency in near IR range Example of a good photometric night. ... Distribution of atmospheric extinction in MASS Median = 0.23 mag 1-st quartile = 0.20 3-d quartile = 0.27 mag Vertical green line represents theoretical Rayleigh extinction for Shatdzhatmaz (0.16 mag). ...

Еще в разделе: (Показать все результаты (>15) - site2010.sai.msu.ru/ )

... Molecular mechanics force field for boron-containing compounds based on CHARMM parameters and Gillespie-Kepert (GK) model is developed. ... The force field provides an accurate description of experimental X-ray stereochemistries in a wide range of organoboranes, organoborate complexes with polyhydroxy compounds, mixed oligomers of boric acid and borates. Molecular design of polydentate complexing agents: from topological analysis to molecular mechanics . ...

Еще в разделе: (Показать все результаты (>440) - chem.msu.ru/ )

• Long Range Molecular Correlations and Hydrogen Bonding in Liquid Methanol
• Exciplexes on INTERNET
• Moscow University Chemistry Bulletin Vol. 49, No. 4 (2008)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>256) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SCOP famyli:
• SDP home page

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1229) - swx.sinp.msu.ru/ )

... Standard MP4 benchmark . ... Press to visit Firefly version 8.0.0 beta Intel AVX-enabled Core i7 2600K benchmarks page . ... Press to visit PC GAMESS/Firefly version 7.1.F Core i7 940 benchmarks page (Windows 64-bit, HTT and Turbo Boost Technology enabled) . Press to visit PC GAMESS/Firefly version 7.1.E Core i7 benchmarks page (Linux 64-bit, HTT and Turbo Boost Technology disabled) . Press to visit PC GAMESS/Firefly version 7.1.E Core 2 Quadro Q9550 (Yorkfield) benchmarks page . ...

Еще в разделе: (Показать все результаты (>89) - classic.chem.msu.su/ )

• Preliminary PC GAMESS benchmarks on Quad-core Xeon (Clovertown)-based system
• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K
• Not kidding at all: PC GAMESS/Firefly v. 7.1.E benchmarks on Intel Core

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>58) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

Diploma thesis abstract "Pulse Terahertz Spectroscopy of complex Molecules" Smirnova I. N. Some of the vibration frequencies of molecular crystals lie in terahertz range. ... In present work the technique of pulse terahertz spectroscopy is used, to obtain absorption spectra in farinfrared region 10-110 cm-1. The influence of molecular and crystal structure on absorption spectra of molecular crystals is investigated by the example of some amino acids and polypeptides. ...

Еще в разделе: (Показать все результаты (>70) - ofvp.phys.msu.ru/ )

... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

Proposals and projects in the Coordinated Call FP7-ICT-2011-EU- Russia Information Meeting Moscow: 21st October, 2010 EU- Russia Call · First ICT Joint Call with Russia (dedicated INCO Call in WP 11-12); joint calls have already been implemented in other areas of FP7 · Russia is investing in High Performance Computing: No 12 supercomputer in the top500 list is Russian; aiming to enter Top3 already in ...

Еще в разделе: (Показать все результаты (>56) - www.msu.ru/ )

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>6) - www.sciencepark.ru/ )

• MSU Science Park - About us

Depreciative indefinites: evidence from Russian Following Haspelmath 1997, we refer to the meaning 'an unimportant or bad person/thing' as depreciative. ... Russian depreciative and appreciative indefinite pronouns and expressions: (3) On vs'o delaet kak-nibud'. ... Haspelmath 1997), specific indefinites tend to develop appreciative rather than depreciative meanings, while the ones on the right side of the implicational map for indefinites (especially, FCIs) are always depreciative. ...

Еще в разделе: (Показать все результаты (>270) - www.philol.msu.ru/ )

• FDSL-7.5 | Home
• FDSL-7.5 | Call for Papers
• LangueDOC :: Archi :: Alphabet

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>5) - tex.bog.msu.ru/ )

... A+B A+B* A+B A++B+eA+B+ A*+B AB+C AB+C elastic scattering excitation de-excitation ionization (electron loss) charge transfer (electron capture and loss) transfer of excitation re-arrangement reaction Often these processes are studied by observing collisions of atoms or ions with dilute gases. ... It is to be expected that the electronic excitations during atomic collisions in a solid differ in many details from those in a gas, because the electronic structure of the embedded atoms is different. ...

Еще в разделе: (Показать все результаты (>92) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/PhysRevA56_1997_2848NMKab.pdf

Официальный сайт кафедры Математической теории интеллектуальных систем и . ... Сотрудники . ... Сотрудники :: Гасанов Эльяр Эльдарович :: Публикации Гасанова Э.Э. ABSTRACT . ... Say is an instantly solvable search problem if there exist algorithm , solving , such that . ... Then ISP (which is called problem of search of identical objects) is instantly solvable search problem, and . ... Then ISP (which is called -dimensional interval search problem) is instantly solvable search problem, and . ...

Еще в разделе: (Показать все результаты (>57) - www.intsys.msu.ru/ )

• Intelligent Systems :: Research
• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>12) - comphep.sinp.msu.ru/ )

• extra:model:main [CompHEP]

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• RNA Kinetics main page

Sample Submission Form for Example Measurements In order to provide the best and most appropriate measurement/results, the customer is asked to please fill in the following form and enclose it with the sample. This form or equivalent information is required prior to the sample measurements. ... WITec can not provide specialised sample preparation. Measurement Goal: What's the goal of the measurement? ...

Еще в разделе: (Показать все результаты (>11) - nano.msu.ru/ )

• Composite Nanomaterials Master?s Program | MSU Nanotechnology Education and
• Announcement about the admission to MSU Graduate School for a new Master?s

The laboratory runs currently several scientific projects aimed at the foundations of quantum information science (the theories of quantum measurement and entanglement, design and analysis of quantum cryptographic protocols, atoms dynamics in optical dipole trap, etc.), applications of quantum theory to modeling quantum interference phenomena in multilevel atoms interacting with optical and magnetic fields (dark resonance spectroscopy), and exploring ... Physics 96 (4), 629-642 (2003). ...

Еще в разделе: (Показать все результаты (>74) - qilab.phys.msu.ru/ )

... Measurement of the MASS detectors parameters with mass program January 24, 2015 [112707] . MASS/DIMM electronics. ... Turbina-core(D): Dimm User Guide. ... N.Shatsky, V.Kornilov, The revision of the MASS/DIMM star catalogue. ... О.Возякова, В.Корнилов, Н.Шатский, Новое программное обеспечение прибора MASS/DIMM. ... V.Kornilov, N.Shatsky, S.Potanin, O.Voziakova, B.Safonov Preliminary results of astroclimate parameters measurements at the Sternberg 2.5m telescope installation site. ...

Еще в разделе: (Показать все результаты (>26) - curl.sai.msu.ru/ )