... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>262) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SCOP famyli:
• SDP home page

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1228) - swx.sinp.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... On this page we collect references to our resources, documentation and resources on other sites. All these data are very helpful for everybody who wants to learn practical quantum chemistry. Firefly (PC GAMESS) main page . ... ERG group wrote some articles about visualization: . ... Нет комментариев " Quantum chemistry information page " . ... Quantum chemistry information page . ... 2015 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>23) - erg.biophys.msu.ru/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>20) - comphep.sinp.msu.ru/ )

• extra:model:main [CompHEP]

Официальный сайт кафедры Математической теории интеллектуальных систем и . ... Сотрудники . ... Сотрудники :: Гасанов Эльяр Эльдарович :: Публикации Гасанова Э.Э. ABSTRACT . ... Say is an instantly solvable search problem if there exist algorithm , solving , such that . ... Then ISP (which is called problem of search of identical objects) is instantly solvable search problem, and . ... Then ISP (which is called -dimensional interval search problem) is instantly solvable search problem, and . ...

Еще в разделе: (Показать все результаты (>53) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling
• Intelligent Systems :: Research

Download FDSL 7.5 flyer ! home . ... The 7.5th European Conference on Formal Description of Slavic Languages, Moscow, December 6 8, 2008 . The European Conference on Formal Description of Slavic Languages was first held in 1995 at the University of Leipzig. Up till 2006, the biannual FDSL was hosted in turn by the University of Leipzig and Potsdam University. ... December 6 8, 2008 . ... FDSL 7.5 (halftime) will be held on December 6 8, 2008 at the Independent University of Moscow. ...

Еще в разделе: (Показать все результаты (>275) - www.philol.msu.ru/ )

• FDSL-7.5 | Call for Papers
• LangueDOC :: Archi :: Alphabet

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>8) - hcs.cmc.msu.ru/ )

• Master program "Enterprise Information Systems" | Магистерское и послевузовское

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>6) - www.sciencepark.ru/ )

• MSU Science Park - About us

... H: · 1 ­ Al2O3­Na3AlF6 (T - x) = 1 , ­ , ­ 1 ( ­ ); · 1 ­ Na2SO4­H2O (T - x) = 1 ( ); · 25° ( .. ... Na2SO4­H2O Na2SO4 10H2O, Na2SO4 + 10H2O Na2SO4 10H2O. , , , . ... 6, 7) LiBr KBr, , : L LiBr() + KBr() . ... 1) , , KBr. ... L. PbTe­SnTe PbSe­SnSe PbTe PbSe, , (.. ... BeF2­LiF , ( ), LiBeF3 Li2BeF4 BeF2­LiF (. ... LiBeF3 280°, BeF2 Li2BeF4 : LiBeF3 () ­ Na2SO4 7H2O: Na2SO4 + 7H2O Na2SO4 7H2O. : Na2SO4 7H2O() Na2SO4 10H2O() Na2SO4 () Na2SO4 () +L 24° BeF2 () + Li2BeF4 () . ... Na2SO4­H2O Na2SO4­H2O....

Еще в разделе: (Показать все результаты (>40) - www.inorg.chem.msu.ru/ )

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>7) - tex.bog.msu.ru/ )

... 4) Percolation probability: [pic] , where L is linear size of lattice. ... The presence of obstacles in a system leads to: - increase of the critical concentration value; this effect grows with increase of the full area of obstacles and falls with increase of the linear size of ones. - increase of the critical exponent ( value; this effect increase with growth both of linear size of obstacles and of their full area. - increase of the growth rate of ...

Еще в разделе: (Показать все результаты (>53) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/poster-sessions.html
• http://acat02.sinp.msu.ru/presentations/ivanchenko/iv.pdf
• http://acat02.sinp.msu.ru/presentations/brun/Exercises_2.doc

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Properties and functions of humic substances: potential implications for environmental protection . ... Director of NATO-ARW, Dr. Norbert Hertkorn. ... Perminova, I.V. Mediation effects of humic substances in polluted environments: implications for development of remediation technologies. ... Bollag, J.-M. Detoxification of contaminated soils via oxidative coupling of organic ecotoxicants to humic substances. ...

Еще в разделе: (Показать все результаты (>166) - mgumus.chem.msu.ru/ )

• MGUMUS -- Irina V. Perminova

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• RNA Kinetics main page

... Laboratory of Mathematical Methods of Image Processing . ... Image analysis . ... Ringing effect . ... Ringing effect so known as Gibbs phenomenon in mathematical methods of image processing is the annoying effect in images and video appeared as rippling artifact near sharp edges. ... Ringing effect is usually introduced to image after different image processing algorithms. ... Scale-space method of image ringing estimation // In: Proceedings of International Conference on Image Processing (ICIP'09)...

Еще в разделе: (Показать все результаты (>97) - imaging.cmc.msu.ru/ )

• Ringing effect modeling | Laboratory of Mathematical Methods of Image...
• Software projects | Laboratory of Mathematical Methods of Image Processing
• Research | Laboratory of Mathematical Methods of Image Processing

Femtosecond Time-Resolved Transverse Kerr Effect Measurements in Magnetoplasmonic Crystals A. Yu. ... Application of external magnetic field to a magnetic medium causes alteration of reflected light amplitude that is so-called magneto-optical Kerr effect. ... For example, excitation of surface plasmon polaritons (SPP) in a magnetized sample by femtosecond laser pulses can lead to time moduation of magneto-optical transversal Kerr effect (TKE) intensity that differs from its steady-state value. ...

Еще в разделе: (Показать все результаты (>78) - nanolab.phys.msu.ru/ )

• Ultrafast plasmonics and magnetoplasmonics | Laboratory of Nanophotonics &

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>1428) - zmmu.msu.ru/ )

• Index of /files/design
• Russian Journal of Theriology
• The Seliger вАУ Moscow hybrid zone between chromosome races of common shrews

The laboratory runs currently several scientific projects aimed at the foundations of quantum information science (the theories of quantum measurement and entanglement, design and analysis of quantum cryptographic protocols, atoms dynamics in optical dipole trap, etc.), applications of quantum theory to modeling quantum interference phenomena in multilevel atoms interacting with optical and magnetic fields (dark resonance spectroscopy), and exploring ... Physics 96 (4), 629-642 (2003). ...

Еще в разделе: (Показать все результаты (>78) - qilab.phys.msu.ru/ )