ISSN 1560-3547, Regular and Chaotic Dynamics, 2015, Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 703 Then the system under study equation): 1 = = 2 3 = takes the following form (we deleted two multipliers from every (F (2 )+ F (3 ))1 (-1+2F (3 ) - 1 2 ), (F (3 )+ F (1 ))2 (-1+2F (1 ) - 2 2 ), (F (1 )+ F (2 ))3 (-1+2F (2 ) - 3 2 ). ... Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 709 function, the system takes the form (4.2). ...

Еще в разделе: (Показать все результаты (>122) - ics.org.ru/ )

• Institute of Computer Sciences - Publications

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>6) - npidb.belozersky.msu.ru/ )

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

VES visualization as the dependence Rho a =f ( r ) is suitable for analysis of only HLS . ... For that the special visualization program IPI-2D was developed, which helps to draw VES data in many forms. a) Rho a cross-sections for AMN & MNB pole-dipole arrays give the first representation of structure under investigation, its inhomogeneity and NSI influence (see fig.7 ). b) D - transformations gives the difference between AMN & MNB (D) and its horizontal derivative - dD/dX (R) . ...

Еще в разделе: (Показать все результаты (>57) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

Geometric Structures in Integrable Systems Sergey Adzhiev (with Victor Vedenyapin), Entropy for generalised quantum kinetic and Liouville equations. Abstract: In his 1872 paper L. Boltzmann proved H-theorem for a class of kinetic equations. ... Abstract: P. Clarkson and M. Kruskal (1989) proposed a method for finding reductions of partial differential equations with two independent variables. ... Gennady El, Kinetic equation for a soliton gas ­ a new integrable system? ...

Еще в разделе: (Показать все результаты (>52) - new.math.msu.su/ )

• http://new.math.msu.su/department/probab/bsk11_13.htm
• Rozhdestvenskiy Aleksey Valeryevich | Department: General Problems of Control.

Динамическое задание параметров апплета из JavaScript . ... Задание слоев и их элементов . ... Элементы в созданный слой добавляются с помощью методов: изменение элемента слоя по номеру элемента set_layer_element_num( int num, String atr_name, String atr_value ) num - номер элемента , если num 0, или максимального, то при значении atr_name object выполняется добавление нового элемента , иначе замена существующего ... задание списка групп слоев для поиска активных элементов . ...

Еще в разделе: (Показать все результаты (>50) - adept.srcc.msu.ru/ )

NMW survey overview . Access image archive . ... The New Milky Way survey aims to detect bright (V<13.5) optical transients near the Galactic plane using an automated wide-field (8x6 deg.) system capable of surveying the whole Milky Way area visible from the observing site in one night. ... All images obtained during the transient search survey are available online (please use the image archive access form ). ... Images per field: . ... Images per night: . ... Milky Way imaging time: . ...

Еще в разделе: (Показать все результаты (>3) - scan.sai.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Two-dimension linear regression model. ... The econometric modeling of time series . ... The course aims to provide students with basic models and methods of econometric modeling of financial time series. ... The course considers in detail the major methods of econometric modeling of time series, in particular modeling by stochastic processes, modeling of stationary and non-stationary time series, the spectrum analysis of time series. ... The problem of tax optimization under a given state budget. ...

Еще в разделе: (Показать все результаты (>8) - io.cmc.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>15) - tukachev.flogiston.ru/ )

• Category: Новости

... Advanced chapters of operation research . Algebraic characterization of basic solution of linear program. ... Advanced chapters of Actuarial Mathematics . ... Discounted cash flow analysis and capital budgeting as decision tools are given particular emphasis. ... In the first part of the course we present a modern approach to modeling economic systems. ... The problem of tax optimization under a given financing budget. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>19) - hcs.cmc.msu.ru/ )

PHYSICAL REVIEW A 68, 022309 2003 Entangling quantum measurements and their properties B. A. Grishanin* and V. N. Zadkov International Laser Center and Department of Physics, M. V. Lomonosov Moscow State University, 119899 Moscow, Russia Received 20 December 2002; published 20 August 2003 We study the mathematical structure of superoperators describing quantum measurements, including the entangling measurement --the generalization of the standard quantum ...

Еще в разделе: (Показать все результаты (>73) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/JETP-1996-82(6)-en.pdf
• http://qilab.phys.msu.ru/papers/Laser-Phys-Lett-2004.pdf
• http://qilab.phys.msu.ru/papers/LasPhys-2000-10(6)-en.pdf

... The WienerHopf functional equation is formulated and studied. ... This formula enables to express the far-field diagram, depending on two variables (the angle of incidence and the angle of scattering) as the combination of 4 functions depending on one variable. ... 3 Analytic prop erties of the unknown functions Functional equation (2.5) contains 5 unknown functions. To make it possible to solve this equation, one should impose some additional restrictions on the unknown functions. ...

Еще в разделе: (Показать все результаты (>41) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/photos/achievements/asa_2013.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/grating5.pdf
• A.V.Shanin

... We computed the permanently shadowed areas and temperatures inside the craters for the variation of the position of the lunar pole of rotation with respect to the ecliptic pole with a period of 18.6 years. ... According to our results, the total permanently shadowed area in the polar craters of the Moon is equal to 50428.7 km2, or 0.13% of the total area of the lunar surface [3]. ... The area of permanently shaded part of a crater makes 59 % from all area of a crater [3]. ...

Еще в разделе: (Показать все результаты (>77) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Shev/Publications/m44_76_sinitsin_shevchenko.pdf
• http://selena.sai.msu.ru/Ber/Publications/ms40/88_Yamashita%20et_al.pdf
• Бережной А.А.

... Available trees in the HiForest : hiEvtAnalyzer/HiTree - Event property tree. ... Pb-Pb (2.76 TeV): /eos/ cms /store/group/phys_heavyions/icali/MinBias_Merged.root ( https ://twiki.cern.ch/twiki/ bin /viewauth/ CMS /HiForest#Data ) P-Pb (run 202792): /afs/cern.ch/user/t/tuos/work/public/pPb/Data/ PAPhysics-pt01-full_WithCentrality.root ( https ://twiki.cern.ch/twiki/ bin /viewauth/ CMS /PPbCentralityAna , https ://twiki.cern.ch/twiki/ bin /viewauth/ ...

Еще в разделе: (Показать все результаты (>33) - lav01.sinp.msu.ru/ )

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>6) - physcontrol.phys.msu.ru/ )

• List All Categories

... Paul Baum (Penn State University) . Dirac Operators and K theory for discrete groups . In this talk the BC (Baum-Connes) conjecture for discrete groups is reformulated using Dirac operators. ... Algebras of functions on stratified spaces . ... A. Connes proved that Hochschild homology of the algebra of smooth functions on a manifold corresponds to the Rham complex and that periodic cyclic homology (of the algebra) corresponds to the de Rham cohomology (of the manifold). ...

Еще в разделе: (Показать все результаты (>139) - higeom.math.msu.su/ )

• Conferences (English)
• Publications (English)
• Publications (Russian)

... FPGA design, architecture, means and methods of work. ... FPGA stands for Field-Programmable Gate Array, which is a semi-conductive crystal, the connections between gates of which and the logic of work can be modeled and changed repeatedly during its work. ... Each semester has 12 obligatory classes of four (4) academic hours each once a week, which totals in 48 hours per semester. ... In spring semester students have 44 hours to work on their term papers on design and then 4 hours for defending...

Еще в разделе: (Показать все результаты (>44) - engineering.phys.msu.ru/ )

• Circuit Diagnostics
• Microcontroller Programming

... Faculty of Physics . M.V.Lomonosov Moscow State University . 7 (495) 939-16-82 info@physics.msu.ru . ... Contacts . ... Education . ... Dr. Michael Tribelsky (Faculty of Physics, Lomonosov Moscow State Univ.) in cooperation with his colleagues from the Institut Fresnel (France) and the Univ. of Cantabria (Spain) discovered a possibility of using dielectric spheres with a high refractive index as multifunctional elements of optical devices. ... 7 495 939-16-82, . ... Faculty of Physics, 2016 . ...

Еще в разделе: (Показать все результаты (>72) - phys.msu.ru/ )

• Гумбольдтовская лекция на физфаке