The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>66) - geophys.geol.msu.ru/ )

• Anis. Page2
• TES. Field example.
• TES tecnology. MSU.

... Faculty of Physics . ... Online journals . ... Access to the E-library is open from any computer in the intranet of the Faculty connected to the Internet. ... URL link: http://www.iop.org/EJ/ These journals can be accessed on-line from any computer in the intranet connected to the Internet. ... URL link: http://www.elsevier.com/wps/find/journal_browse.cws_home/P12?pseudotype= =Title 1Code=P12 =A These journals can be accessed on-line from any computer in the intranet connected to the Internet. ...

Еще в разделе: (Показать все результаты (>3) - www.phys.msu.ru/ )

... help . find changesets by author, revision, files, or words in the commit message Syntax for Mercurial Ignore Files Synopsis -------- The Mercurial system uses a file called ".hgignore" in the root directory of a repository to control its behavior when it searches for files that it is not currently tracking. ... An untracked file is ignored if its path relative to the repository root directory, or any prefix path of that path, is matched against any pattern in ".hgignore". ...

Еще в разделе: (Показать все результаты (>11871) - kodomo.fbb.msu.ru/ )

• Help: phases
• allpy: sandbox/wx-dc.py diff

... Revision Log Mode: Stop on copy Follow copies Show only adds and deletes View log starting at and back to . ... edit) . ... 5 years . me.dendik . ... Added rule to evade trapping yourself while eating for e4 snake . ... Added "run mostly forward" rule to e2 snake . ... Changed display names in e2, e4 snakes (they were both Example тАж . ... e4 snake now tries to zig-zag . ... Added two smarter snakes: e2 and e4 . ... snakes added . ... Added example empty snake . ... Added example snake . ...

Еще в разделе: (Показать все результаты (>384) - kodomo.cmm.msu.su/ )

... Home > Scientific laboratories > IM . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... In the area of energy and space, examples of topical engineering problems LIM is involved in, include the numerical simulation of new-generation atomic plants and computational aeroacoustics. ... Source URL: http://en.cs.msu.ru/laboratories/im . ...

Еще в разделе: (Показать все результаты (>97) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• Laboratory of Mathematical Methods of Image Processing | CMC MSU
• Laboratory of Mathematical Methods of Image Processing

... importance of terms such as 'geosols', 'paleosols' etc with interest. ... new zealand perspective is similar to that of Dr Crook of Australia - the . ... Some Quaternarists in New Zealand use 'buried soil' instead of buried . paleosol and the distinction is one of preference in the end (e.g Almond . ... I use the simple definition of a paleosol as a soil of a past landscape or . ... paleosols, and exhumed paleosols. ... surface' or 'non-buried' paleosols because these soils are clearly in the . ...

Еще в разделе: (Показать все результаты (>171) - www.fadr.msu.ru/ )

• Proposition
• NAP - subject matter topics
• PROTOCOL of Paleopedology Commission Business Meeting at V International

Wireshark · · · · · (Win, Mac, Linux) Open Source (http://www.wireshark.org) · · · ( ) · 2 1 · # usermod ­a ­G wireshark user · wireshark root user@host:~$telnet ya.ru 80 Trying 213.180.193.3.. ... MAC 2. MAC IP ARP 3. L4 Interface # 1 2 3 4 Domain # 1 1 Eth Address 00:00:00:00:00:0a 00:00:00:00:00:09 IPv4 Address 10.0.1.2 10.0.1.1 10.0.2.2 10.0.0.3 Flow # 1 2 Src Itf # 1:49153 3:49153 Dst Itf # 4:234 1:432 Protocol TCP UDP Edges 1-2 1-2 .. ...

Еще в разделе: (Показать все результаты (>5) - lvk.cs.msu.su/ )

Официальный сайт кафедры Математической теории интеллектуальных систем и . ... Сотрудники . ... Сотрудники :: Гасанов Эльяр Эльдарович :: Публикации Гасанова Э.Э. ABSTRACT . ... Say is an instantly solvable search problem if there exist algorithm , solving , such that . ... Then ISP (which is called problem of search of identical objects) is instantly solvable search problem, and . ... Then ISP (which is called -dimensional interval search problem) is instantly solvable search problem, and . ...

Еще в разделе: (Показать все результаты (>51) - www.intsys.msu.ru/ )

• Options dialog
• Intelligent Systems :: Research :: :: Articles
• Intelligent Systems :: Teaching :: Seminars :: Список специальных семинаров

... About lab . ... MSU Graphics & Media Lab (Video Group) . The filter is designed for oil-painted and animated cartoon rendering from input video. MSU Cartoonizer filter has many parameters, which allow to obtain very interesting results. This is the first filter developed by Graphics & Media Lab connected with non-photorealistic rendering. ... The image showing results of MSU Cartoonizer for landscapes. source frame of movie . ... Filter for VirtualDub MSU Cartoonizer (126 KB, ZIP) . ...

Еще в разделе: (Показать все результаты (>210) - graphics.cs.msu.ru/ )

• Moving object phases representation | Graphics and Media Lab
• Creation of cartoons from video | Лаборатория компьютерной графики и...
• Road monitoring | Graphics and Media Lab

... 2008. NONHOLONOMIC MECHANICS Gauss Principle and Realization of Constraints V. V. Kozlov* V.A. Steklov Institute of Mathematics, Russian Academy of Sciences, ul. ... From (3) it immediately follows that an actual motion is a virtual one. ... x (10) If one considers this relation as a definition of virtual motions, then the generalized Gauss principle leads to the equation x=- Е ,x x, (x, x) V x which also has the integral of energy, but differs from the initial equation (9). ...

Еще в разделе: (Показать все результаты (>113) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/4d3/110-kovalevskaya-exponents-and-poisson-structures_ru.pdf
• http://ics.org.ru/upload/iblock/daf/135-on-justification-of-gibbs-distribution_ru.pdf
• http://ics.org.ru/upload/iblock/968/2544.pdf

... HPF-DVM) . Language specification . ... 5 ALIGN and REALIGN directives . ... Jacobi algorithm PROGRAM JACOBI PARAMETER (K=8, ITMAX=20) REAL A(K,K), B(K,K) *HPF$ DISTRIBUTE A (BLOCK, BLOCK) *HPF$ ALIGN B(I,J) WITH A(I,J) C arrays A and B with block distribution PRINT *, '******** TEST_JACOBI_HPF ********' C nest of two independent loops, iteration (i,j) will be executed C on processor, which is owner of element A(i,j) *HPF$ INDEPENDENT DO 1 J = 1, K *HPF$ INDEPENDENT DO 1 I = 1, K A(I,J) = 0. ...

Еще в разделе: (Показать все результаты (>99) - sp.cs.msu.ru/ )

• DVM-system. Goals and structure
• DVM-system. Installation guide. Version 3.15
• DVM-system. Installation guide. Version 3.30

О лаборатории . ... Лаборатория теоретической биофизики . ... This Python module parses Gaussian cube files, produced by quite a few QM software packages, and makes volume data available as numpy array as well as some associated properties. ... Нет комментариев " Gaussian Cube files loader " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>34) - erg.biophys.msu.ru/ )

• python ERG Research Group: Лаборатория теоретической биофизики
• Visualize partial charges in PyMol ERG Research Group: Лаборатория
• Scanning PES ab initio and in MM ERG Research Group: Лаборатория теоретической

... Seminar archive . ... Type Ia Supernovae (SNe Ia) have an important role to measure a distance to an anonymous galaxy because they have a good correlation of the decline rates of the light curves with the absolute luminosity. ... First, super-Chandrasekhar SNe which have extremely high luminosity, slow decline rate of the light curves, slow expansion velocity and strong carbon features. ... As another example of diversity of SNe Ia, I would like also to introduce Type Iax SNe. ... All seminars: . ...

Еще в разделе: (Показать все результаты (>26) - master.sai.msu.ru/ )

• YaB-100 - Asteroid
• SAI Space Monitoring Laboratory
• YaB-100 - Biography

News and Events . Bat Research . Russian Bats . ... Here we propose to post our web page updates and provide information on events happening in Russian bat research not directly connected with this site (conferences, symposia, new publications etc.), which may be of interest to our visitors. This page consists of the following topics: MAIN NEWS , NEW PUBLIC EVENTS (Conferences etc.) BAT RESEARCH NEWS , information on NEW PUBLICATIONS , . ... NEWS OF THIS WEB SITE . ... Bats of Vietnam. ...

Еще в разделе: (Показать все результаты (>1433) - zmmu.msu.ru/ )

• Uropatagium venation pattern in bats as diagnostic character (by the example of
• Russian Journal of Theriology
• RBR homepage

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

M.H. Shulman, 2006 Michael H. Shulman TIME AND QUANTUM BEHAVIOR The paper presents an abstract of my talk at the Russian Interdisciplinary Temporology Seminar (23 of May, 2006th ). ... The following statements are argued: · The World time-space structure including its relativistic features are due to the quantum object features. Thanks to de Broglie we understood that each quantum object corresponds with some wave. ... A mathematic "exotics" of the quantum physics consists in two components. ...

Еще в разделе: (Показать все результаты (>367) - chronos.msu.ru/ )

• A. P. Levich
• LOGIC OF CAUSAL MECHANICS: OBSERVATIONS-THEORY-EXPERIMENTS
• Laboratory-chair of Discrete mechanics on a microscopic scale

... Robert Hermann Brookline, MA (Received November 22, 1999) der to illustrate the obvious progress, one can mention a variety of examples. ... In or- FYI Item "BMS Report on Institutes" As a member of the panel commissioned by the Board on Mathematical Sciences of the National Research Council, I write to correct several inaccuracies in the "For your information" note by Allyn Jackson entitled "BMS Report on Institutes" in the December 1999 issue of the Notices. ...

Еще в разделе: (Показать все результаты (>71) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/IJBC_3body_problem.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/Zemskov+Loskutov_EPJB_2011.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/IJBC_thermodyn_bill.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

... Departments . ... Regional Geology and Earth History . ... Members of the Chair give lectures on Structural Geology and Geological Mapping; Historical Geology; Geology of Russia and CIS; Geoinformation Systems in Geology; Information Science and Application of Computer Technologies in Geology; Legal Basics, Economics and Organization of Geological Survey as well as deliver a number of specialized courses in the field of stratigraphy, sedimentology, marine geology, geology of terrestrial planets. ...

Еще в разделе: (Показать все результаты (>98) - www.geol.msu.ru/ )

• MSU-Geological Faculty-Department of Paleontology
• Faculty of Geology >> Geology at Moscow State University
• Download Yuri Shvarov's files

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>52) - brain.bio.msu.ru/ )

• Other prospects of the change-point based analysis
• Change-points at different levels of the hierarchy of EEG segmental...