Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>4) - tex.bog.msu.ru/ )

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>157) - www.pereplet.ru/ )

. Frames are requied

Еще в разделе: (Показать все результаты (>2) - www.radio-msu.net/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Hobby >> Zone >> Re: Rambo's Kill Count and Statistics . ... Re: Rambo's Kill Count and Statistics [ re: plop ] . ... Re: Rambo's Kill Count and Statistics [ re: sokol ] . ...

Еще в разделе: (Показать все результаты (>1961) - www.snto-msu.net/ )

• [News] Научное программное обеспечение - Public forum of MSU united student
• Listing available drive partitions - Public forum of MSU united student...
• Персональная информация о available - Public forum of MSU united student

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Hobby >> Zone >> Re: Rambo's Kill Count and Statistics . ... Re: Rambo's Kill Count and Statistics [ re: plop ] . ... Re: Rambo's Kill Count and Statistics [ re: sokol ] . ...

Еще в разделе: (Показать все результаты (>3358) - www.fds-net.ru/ )

• debian sucks or i suck - Public forum of MSU united student networks
• DII - no realms are available right now - Public forum of MSU united student
• [News] Научное программное обеспечение - Public forum of MSU united student

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

NGS Data Analysis with Unipro UGENE Olga Golosova, Yuriy Vaskin, German Grekhov, Yuliya Algaer UNIPRO, Lavrentieva ave. ... That is where Unipro UGENE NGS framework comes in play. ... Moreover, the UGENE toolkit allows one to automate common tasks by creating workflows with the integrated tools using the UGENE Workflow Designer. Analysis of NGS data with UGENE may start, for example, from quality control of raw NGS data, received from a sequencing facility, with the integrated FastQC [3] tool. ...

Еще в разделе: (Показать все результаты (>247) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/181.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/53.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/41.pdf

... Data . ... Services . ... Solar energetic particles . ... N -d SW Conditions : Time profiles of the key geomagnetic ( Ap and Dst indices), solar wind (velocity V , density n and temperature T ) and IMF ( B , Bx , By , Bz in GSM) parameters observed in the N day vicinity of the geomagnetic disturbed day. N -d Map of Solar Events : Map of solar surface events occurred within N day vicinity of the moment when the solar wind expansion (which causes the geomagnetic event) started. ... WIND . ...

Еще в разделе: (Показать все результаты (>37) - smdc.sinp.msu.ru/ )

• Scientific services - Space monitoring data center
• Space monitoring data center
• COHO project - Space monitoring data center

A.Nekipelov Modernization of Basic Research in Russia: Russian Academy of Sciences' (RAS) Vision Russia stands among the few countries of the world engaged in basic research along all its principal avenues. ... For example, in 2008 the total share of Candidates of Science engaged in Russian research organizations made 20.2% and that of Doctors of Science 6.7% whereas in RAS institutes the indicators were 43.0 and 19.0% respectively. ... The key link in basic research is a scientific laboratory. ...

Еще в разделе: (Показать все результаты (>24) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/Ayvazyan_Introduction_to_the_textbook_on_econometrics.pdf

VIEWS Paul Murdin M T Wright Data, information and science I was one of almost half the IAU General Assembly that voted against the IAU resolution initiated by Elizabeth Griffin in Manchester in August 2000. ... The IUE archive, for example, delivers ultraviolet spectra into the hands of the community at the same rate that the satellite itself used to do, and papers frequently appear that are based on the archive. Other space missions like ISO and XMM have and are completing similar archives. ...

Еще в разделе: (Показать все результаты (>91) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/gorm/dating/tldating.pdf
• http://hbar.phys.msu.ru/gorm/fomenko/fomenko2.pdf
• newtrev1.htm

Correlations of Random Binary Sequences with Pre-Stated Operator Intention: A Review of a 12-Year Program1 R. G. Jahn, B. J. Dunne, R. D. Nelson, Y. H. Dobyns, and G. J. Bradish Princeton Engineering Anomalies Research (PEAR) School of Engineering and Applied Science, Princeton University Abstract -- Strong correlations between output distribution means of a variety of random binary processes and prestated intentions of some 100 individual human ...

Еще в разделе: (Показать все результаты (>406) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/GCP.Events.Mar08.prepress.pdf
• Determination analysis as a method for diagnostics of ecosystem condition
• Computers without Clocks

... Instrument panel contains (from left to right): sample fast approach/retract buttons, stepper power supply on/off button (if this feature is enabled in program configuration), show statistics button, sound on/off button, volume control buttons, toggle to small window button (in the small window regime only instrument panel and oscilloscope is shown, window title is reduced, window is always on top of other windows), button that opens About window. ...

Еще в разделе: (Показать все результаты (>73) - www.spm.genebee.msu.ru/ )

Name Last modified Size Description . Parent Directory - _vti_cnf/ 30-Oct-2012 12:19 - filelist.xml 26-Nov-2003 00:39 163 image001.gif 26-Nov-2003 00:39 5.3K . Apache Server at genphys.phys.msu.su Port 80

Еще в разделе: (Показать все результаты (>36) - genphys.phys.msu.su/ )

• Index of /rus/edu/kvant/II_2/STAT2/_private/Statistic.files/_vti_cnf

Electronic publishing for academics: geology and physics in Russian network for natural sciences PAVEL PLETCHOV2; ALEXEY KRASHENINNIKOV1,*; ALEKSEI SELIVERSTOV1; SERGEI TRUSOV2; VADIM USTIANSKY3 1 Physics Department, M.V.Lomonosov Moscow State University 119992, Moscow, GSP-2, Leninskie Gory, Russian Federation e-mail: avs@phys.web.ru; acrush@phys.web.ru 2 Geology Department, M.V.Lomonosov Moscow State University 119992, Moscow ... Data storage and processing architecture of the servers. ...

Еще в разделе: (Показать все результаты (>404) - geo.web.ru/ )

• Авторский сайт Владимира Мальцева - литература
• XXXI Конгресс Международной ассоциации гидрогелогов "New Approaches to
• Mineral Drawings site. Books,references,aesthetical genetic mineralogy

... The University Information System RUSSIA (UIS RUSSIA) has been designed and is maintained as a corporate digital library for research and education in economics and social sciences. ... The RF State Statistical Agency publications are processed and arranged into databases «Regions of Russia», «Cities» and «Municipalities». The databases update indicators on 83 RF regions, 1071 cities and 25000+ municipal units. ...

Еще в разделе: (Показать все результаты (>121) - srcc.msu.ru/ )

Academy of Science, Engineering and Technology International Journal of Mathematical, Computational, Physical and Quantum Engineering Vol :8 No:10, 2014 Application of Adaptive Neural Network Algorithms for Determination of Salt Composition of Waters Using Laser Spectroscopy Tatiana A. Dolenko, Sergey A. Burikov, Alexander O. Efitorov, Sergey A. Dolenko ... Nickolov, "Determination of salts in water solutions by a skewing parameter of the water Raman band," Applied Spectroscopy, vol. 38, no. 4, pp. ...

Еще в разделе: (Показать все результаты (>23) - rswater.phys.msu.ru/ )

• http://rswater.phys.msu.ru/Assets/Water/OMNN_2010.pdf

... help . find changesets by author, revision, files, or words in the commit message Template Usage Mercurial allows you to customize output of commands through templates. ... Usage: $ hg log -r1 --style changelog A template is a piece of text, with markup to invoke variable expansion: $ hg log -r1 --template "{node}\n" b56ce7b07c52de7d5fd79fb89701ea538af65746 Strings in curly braces are called keywords. ... The changeset bisection status. bookmarks List of strings. ...

Еще в разделе: (Показать все результаты (>9712) - kodomo.fbb.msu.ru/ )

• allpy: 497de2152849 README.devel
• Index of /FBB/year_06/term1/Pr_7/Examples
• allpy: 497de2152849 sandbox/wx-dc.py

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Alignment example
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... In particular, Jmol.js uses the split version. ... To invoke JmolApplet.jar from Jmol.js, either: a) put it in the folder containing the HTML page requiring it and do not use jmolInitialize() or b) identify it explicitly in jmolInitialize(), for example: jmolInitialize("folder-containing-jar-files", "JmolApplet.jar") - JmolAppletSigned.jar An equivalent version of the applet, but this is a "signed" or "trusted" applet (a term in Java security language). ...

Еще в разделе: (Показать все результаты (>71) - monkey.belozersky.msu.ru/ )

• DNA/RNA-Protein structures
• SDP home page
• Example of supporting positions

Application of the V--Ray Technology for Optimization of the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D Supercomputers Alexander S. Antonov, Vladimir V. Voevodin Moscow State University, Russia e­mail: voevodin@vvv.srcc.msu.su Abstract The paper shows an application of the so­called V­ Ray Technology for optimizing the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D supercomputers. ... Results for CRAY Y­MP supercomputers. al structure of the program. ...

Еще в разделе: (Показать все результаты (>7) - asa.guru.ru/ )

• Alexander Antonov's Resume