... Manuscripts submitted to the journal should be divided into the following sections: Title page, Abstract (in Russian and English), Key words (in Russian and English), main manuscript text, list of references, tables, figures and figure captions. ... Full size of the article includes list of references, tables and figures. ... Rich text format (*.rtf) . ... References are given in the text in square brackets; full references are given at the end of the manuscript in the section List of references. ...

Еще в разделе: (Показать все результаты (>25) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/vestnic/rukop_eng.doc

Symbolic circuit-matrix processor and evaluator . ... This software is reliable over the range of benchmark circuit complexity (both *.CIR and *.MAT file). ... SYMBOL is a symbolic-algebra package which in contrast to REDUCE, MACSYMA, MAPLE, MATHEMATICA, MathLAB, MathCAD and other known multi-purpose systems is especially intended for analysis of any lumped, linear, time-invariant circuit. ... pure ASCII text . ... CIRSYM - SYMbolic CIRcuit processor used to format ASCII text file *.out for CALCSYM. ...

Еще в разделе: (Показать все результаты (>6) - astrometric.sai.msu.ru/ )

Geometrical core (core) is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chains. ... Minimal core size (#aa's) . ... Alternative core new atoms (%) . ... Geometrical core is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chain. ... Each input sequences is aligned to the corresponding sequence obtained from the ATOM section of the protein chain in the PDB file. ...

Еще в разделе: (Показать все результаты (>404) - mouse.belozersky.msu.ru/ )

• S : rm_systems

Detoxifying Ability of Coal Humic Acids and Their Hydroquinone Enriched Derivatives in relation to Copper under Field Conditions Natalia Kulikova1, Vladimir Kholodov2, Galina Lebedeva1, Olga Philippova1, Anton Kovalenko3, Irina Perminova 1 3 Department of Soil Science, M.V. Lomonosov Moscow State University, Leninskie Gory, 119992 Dokuchaev ... 761 Detoxifying activity of the humic preparations was estimated by two-years field experiments conducted under sod-podzolic soil conditions. ...

Еще в разделе: (Показать все результаты (>138) - mgumus.chem.msu.ru/ )

• Instructions for book-contributors
• Humates NATO ARW Home Page

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>4) - mouse.genebee.msu.ru/ )

... subject to AIP license or copyright; see http://jap.aip.org/about/rights_and_permissions JOURNAL OF APPLIED PHYSICS 111, 07A946 ( 2012 ) Resonant surface magnetoplasmons in two-dimensional magnetoplasmonic crystals excited in Faraday configuration A. V. Chetvertukhin,1 A. V. Baryshev,2 H. Uchida,3 M. Inoue,2 and A. A. Fedyanin1,a) 1 ... In this paper, the longitudinal magneto-optical Kerr effect (LKE) is studied in two-dimensional magnetoplasmonic crystals. ... The angle of incidence h М 45 . ...

Еще в разделе: (Показать все результаты (>86) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/optexp20_10538_2012.pdf
• http://nanolab.phys.msu.ru/sites/default/files/jap111_07a948_2012.pdf

... A New Method of Separation of Variables for Certain Linear Problems of Mathematical Physics . A.Shanin (Department of Acoustics, Faculty of Physics, Moscow State University, Moscow, Russia) . ... It is well known that the traditional procedure of separation of variables is deeply connected with the invariance of the differential operator with respect to a symmetry operator. ... Here we describe the method to transform the PDE boundary problem into the system of ODEs. ...

Еще в разделе: (Показать все результаты (>189) - acs366.phys.msu.su/ )

• Abstract (Invited)

TOWARDS THE EUROPEAN HIGHER EDUCATION AREA CommuniquИ of the meeting of European Ministers in charge of Higher Education in Prague on May 19th 2001 Two years after signing the Bologna Declaration and three years after the Sorbonne Declaration, European Ministers in charge of higher education, representing 32 signatories, met in Prague in order to review the progress achieved and to set directions and priorities for the coming years of the process. ...

Еще в разделе: (Показать все результаты (>53) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/documents/umo/bologne/Magna%20Charta%20Universitatum.pdf
• http://www.socio.msu.ru/documents/umo/bologne/Message%20from%20the%20Salamanca%20Convention%20of%20European.pdf

... The term " safety culture " appeared in 1988, it has been stipulated by the Chernobyl catastrophe. ... Different definitions will be collated in the presentation; a necessity to develop a quantitative approach to safety culture will be demonstrated. ... What is the role of human errors in safety culture? Operators are often the weak link in any complex system, they are one of the biggest sources of errors in high-risk technologies. ... How to quantify human errors? ...

Еще в разделе: (Показать все результаты (>105) - www.prof.msu.ru/ )

• HUMAN RIGHTS AND DEVELOPMENT
• Us/ Others in the American Cultural Experience
• Swedish Professorship Awards

... PAPERS Coherent Control of Chirality in Ensemble of Randomly Oriented Molecules Using a Sequence of Short Laser Pulses1 D. V. Zhdanov and V. N. Zadkov International Laser Center and Faculty of Physics, Moscow State University, Moscow, 119991 Russia e mail: zhdanov@ phys .msu.ru, zadkov@ phys .msu.ru Received December 29, 2008; published online July 2, 2009 Abstract--The universal algorithm of choosing the train of short laser ... MATHEMATICAL MODEL OF MOLECULAR CHIRALITY 2.1. ... 4) Fig. ...

Еще в разделе: (Показать все результаты (>70) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/LSPH1247.pdf
• http://qilab.phys.msu.ru/papers/PRA22309.pdf
• http://qilab.phys.msu.ru/papers/JCP-127(24)-244312-16(2007)%202.pdf

HOTEL ACCOMMODATION IN MOSCOW We are glad to offer the accommodation for the conference participants in the following hotels. ... Breakfast: buffet table Price: Single room ­ 120 euro Single room comfort ­ 130 euro Double room ­ 140 euro Check-in 12:00, check-out 12:00 DEADLINE for booking and making payment is 1 May 2007 HOTEL Holiday Inn Lesnaya 4**** Address: Moscow, Lesnaya st., 15 Location: The Holiday Inn Moscow Lesnaya hotel is ideally located for both the business and leisure travelers. ...

Еще в разделе: (Показать все результаты (>124) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ekbio/article/JEE00-12.pdf
• http://www.enzyme.chem.msu.ru/~tishkov/Publications/JBiotechnol_97_58_187.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/K_yemash_F_2006.pdf

DESCRIPTION OF THE TIME PROFILES OF KEY GEOMAGNETIC AND SOLAR WIND PARAMETERS . Time profiles of key geomagnetic parameters ( Ap and Dst indices) are shown together with key parameters of the solar wind (velocity V , density n and temperature T ) and IMF ( B , Bx , By , Bz in GSM coordinate system). ... High time resolution data on the solar wind plasma is obtained from Wind experiment in 1997 and ACE experiment in 1998-2002 using ISTP data base . ...

Еще в разделе: (Показать все результаты (>23) - dbserv.sinp.msu.ru/ )

... Ph.D., Head of Department of Economy of Innovative Development, School of Public Administration, Lomonosov Moscow State University. ... In many legislative and statutory acts there are references to innovative activity and innovative relations, in scientific and business environments the concept of venture capital is actively used. ... No material published in this journal may be reproduced in print or in electronic form without a link to "E-journal. Public Administrarion". ...

Еще в разделе: (Показать все результаты (>157) - ee-journal.spa.msu.ru/ )

Preconcentration Laboratory . Laboratory of Chromatography . ... Laboratory of Kinetics Methods of Anaysis . ... Sorption-spectroscopy methods for determination of organic . ... Room-temperature ionic liquds, computational chemistry . ... New detection methods in ion and ion-pair chromatography . ... For that purpose, methods of selective preconcentration are developed along with the methods of determination of analytes directly in the sensing film or in the permeate after membrane diffusion. ...

Еще в разделе: (Показать все результаты (>29) - analyt.chem.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>164) - www.genebee.msu.ru/ )

• Impact Factors of Scientific Journals in 1999
• GeneBee BLAST 2.2.22+ Services Help
• GeneBee BLAST 2.2.8 Services Help

... Font: Times New Roman . ... size - А4 (21 cm х 29,7 cm) . ... Title should be typed in capital letters, Times New Roman, size 13, boldface font; formatting: center. ... The title and the number of the table should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... The title under the illustration should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... Use Times New Roman size...

Еще в разделе: (Показать все результаты (>24) - www.spa.msu.ru/ )

... Gen. 38 (2005) 5531­5546 doi:10.1088/0305-4470/38/24/007 Unfolding of eigenvalue surfaces near a diabolic point due to a complex perturbation O N Kirillov, A A Mailybaev and A P Seyranian Institute of Mechanics, Moscow State Lomonosov University, Michurinskii pr. ... In the case of real symmetric matrices we study the unfolding of eigenvalue surfaces near a diabolic point under real and complex perturbations. ... A real non-symmetric perturbation of a diabolic point. c 0: Im2 + (x + )2 + (y + )2 = 2...

Еще в разделе: (Показать все результаты (>29) - mailybaev.imec.msu.ru/ )

• http://mailybaev.imec.msu.ru/papers/KliemEtAl2006.pdf
• http://mailybaev.imec.msu.ru/papers/SeyranianMailybaev2003.pdf
• http://mailybaev.imec.msu.ru/papers/marchesinmailybaev2008b.pdf

... Departments . ... Head of the department: Moiseev Evgeny, Academician of RAS, Professor, Dr. Sc., Dean of the Faculty CMC MSU Contact information . ... Main topics are: boundary value and spectral problems for PDEs of elliptic and mixed type, spectral analysis, boundary control problems for oscillating processes, linear integral equations, completeness and basis properties of functional systems. ... Functional Analysis by Prof. Moiseev, 64 hours, 5th semester. ... Functional Analysis by Assoc. ...

Еще в разделе: (Показать все результаты (>209) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics
• Laboratory of Industrial Mathematics | CMC MSU
• Department of Functional Analysis and its Applications

University Satellites and . Space Science Education . ... Space methods in education of ecologists . ... Application of space methods at the decision of environmental problems finds reflection in teaching a lot of disciplines of a geoecological cycle baccalaureate and master degree preparations (geology, geography, landscape, a remote quality monitoring of a condition of an environment etc.) ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>36) - cosmos.msu.ru/ )

• Space Scientific and Education project of Lomonosov Moscow State University

... initial value of E in linear potential sweep voltammetry), was derived for reversible reaction O + ne R proceeding in a compact film adsorbed onto an electrode of surface A. A series of inferences from this equation, namely: (1) the appearance of peak current ip at potential value E = Ep (i.e. = 1); (2) the equality of adsorption densities of reduced (R) and oxidized forms (O) to each ... Case II: reaction on the film physical border (including lateral surface of pores). ...

Еще в разделе: (Показать все результаты (>14) - www.elch.chem.msu.ru/ )

• Molecular aspects of solid state and interfacial electrochemistry