... 1, 119899 Moscow, Russian Federation shamolin@imec.msu.ru ABSTRACT This work is devoted to the development of qualitative methods in the theory of nonconservative systems that arise, e.g., in such fields of science as the dynamics of a rigid body interacting with a resisting medium, oscillation theory, etc. ... References [1] M.V. Shamolin, Methods of Analysis of Dynamical Systems with Variable Dissipation in Dynamics of a Rigid Body [in Russian]. ...

Еще в разделе: (Показать все результаты (>36) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-133-1.pdf
• http://shamolin2.imec.msu.ru/art-185-2.pdf
• http://shamolin2.imec.msu.ru/art-160-1.pdf

Online Services | ... This program give to one the possibility to calculate REACTION THRESHOLD and REACTION ENERGY values for any nuclear reaction: . ... Equation for REACTION ENERGY : E react = ( M 1 + M 2 - SUM ) * c 2 , . ... Format of ENERGY value: Energy value energy error . Nucleon Separation Energy Graph Engine is universal program for plotting graph of nucleon separation energies. ... 3) Type and number of nucleon separated (namefield "Reaction") (multiselect field), . ...

Еще в разделе: (Показать все результаты (>21) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• CDFE => Online Services => Nucleus Ground State Parameters

... Give an example of chemical reaction between a salt and an acid leading to the formation of another salt and a base. (1 point) [Solution] . ... Write the reactions of chromium (III) bromide with hydrogen peroxide in acidic and basic media. (2 points) [Solution] . ... In the reactions, specify the structures of all substances. (3 points) [Solution] . ... Three substances A, B, and C were mixed in the amount of three moles each. ... Example problems in chemistry for the entrance exams ( main round ) ....

Еще в разделе: (Показать все результаты (>1357) - chem.msu.ru/ )

• Editorial board
• Entrance Examinations - Main Round
• Moscow University Chemistry Bulletin Vol. 47, No. 3, P. 168 (2006)

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . Dr., head scientist Lidia N. Komissarova . e-mail: komissarova @inorg.chem.msu.ru . ... Multifunctional materials with variable surface structure based on 3rd group element compounds with tetraedric anions. ... Журн. неорган. химии. ... 2006. ... P.Melnikov, L.Komissarova. ... Неорган химии, 2006,51(2),197. ... 2008-2010 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>7) - www.lssm.inorg.chem.msu.ru/ )

... Полезные ссылки . ... 13 сентября 2012 года в 12.40 в ауд. 107-108 факультета состоится лекция Dr. Suzanne Hilgendorf Sociolinguistics and World Englishes: The State of the Discipline . ... Simon Fraser University, Vancouver, Canada), a visiting professor at Lomonosov Moscow State University, will give a lecture on Sociolinguistics and World Englishes: The State of the Discipline . ... World Englishes. ... The Three Circles of English: Language Specialists Talk about the English Language. ...

Еще в разделе: (Показать все результаты (>28) - ffl.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Comparison of protein phylogeny reconstruction methods

... FPGA design, architecture, means and methods of work. ... FPGA stands for Field-Programmable Gate Array, which is a semi-conductive crystal, the connections between gates of which and the logic of work can be modeled and changed repeatedly during its work. ... Each semester has 12 obligatory classes of four (4) academic hours each once a week, which totals in 48 hours per semester. ... In spring semester students have 44 hours to work on their term papers on design and then 4 hours for defending...

Еще в разделе: (Показать все результаты (>4) - engineering.phys.msu.ru/ )

... Moscow University Press (Moscow University Publishing House) . ... РЕМНЕВА Марина Леонтьевна , д.ф.н., проф., зав. кафедрой русского языка, декан филологического факультета МГУ имени М. В. Ломоносова . ... REMNEVA Marina , PhD, Professor, Head of the Department of Russian Linguistics, Dean of the Philological Faculty, Lomonosov Moscow State University . ... 119991, Moscow, GSP 1, Leninskije Gory, 1/51, Lomonosov Moscow State University, Philological Faculty, of. ...

Еще в разделе: (Показать все результаты (>268) - www.philol.msu.ru/ )

• LangueDOC :: Tools :: Text conversions
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/ongoing_projects.html

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... After the alignments are produced, T-aligner classifies all editing events (U insertion or U deletion) and clusters the reads into three groups: (i) those matching the reference sequence, (ii) those matching the putative main `editing pathway' (i.e., the user-defined final edited product) and (iii) all other reads containing alternative editing events. ... Reads in violation of any of these conditions are placed in the `alternative editing' group. ...

Еще в разделе: (Показать все результаты (>140) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/198.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/217.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/143.pdf

The coordinates, diameters, altitudes and morphological features of all the craters of Mars exceeding 10 km in diameter, totaling 19 308, are compiled. ... The catalogue is intended for use by investigators of Mars, students, in comparative planetology and in the selection of craters for naming. ... 1 one terrace . 2 many terraces . ... 6 many hills and one ridge . 7 one hill and many ridges . ... 1 one crater . 2 many craters . ... Sample craters of different morphological categories . ...

Еще в разделе: (Показать все результаты (>65) - selena.sai.msu.ru/ )

• Родионова Жанна Федоровна
• Morphological Catalogue Of The Craters Of Moon
• Zhanna F. Rodionova

... About Conference . ... Bookstall . All books . Books by MCE participants . ... Password: . ... ФАЗИС, 2001. 464 pages (hardcover) . ... Approximate price in Conference bookstall 1680 roubles. You need to submit Conference application first to order books to Conference bookstall. If you have already registered just enter your username and password. ... 2004 Designed by Lyceum of Informational Technologies ?1533 . ...

Еще в разделе: (Показать все результаты (>146) - www.mce.biophys.msu.ru/ )

Вы посетили: activ_engl.html . ... История кафедры . ... Editor of the special issue of the journal Linear Algebra and its Applications devoted to Idempotent and Tropical Mathematics, 2010 . Editor of the journal Fundamental and Applied Mathematics . ... Linear Algebra and its Applications . Linear and Multilinear Algebra . ... Electronic Journal of Linear Algebra . ... staff/guterman/activ_engl.html.txt Последние изменения: 13.02.2013 11:26 (внешнее изменение) | ...

Еще в разделе: (Показать все результаты (>12) - halgebra.math.msu.su/ )

... About Journal | ... Sociology and Political Science publishes original works on sociology and political science, results of research and experiments in social and political spheres in Russia and abroad, methodological innovations, information about conferences, reviews of the recent books in sociology and political science. ... Please include full article title both in Russian and English. ... Information about the author/authors both in Russian and English. ... References. ...

Еще в разделе: (Показать все результаты (>21) - www.socio.msu.ru/ )

... A new image object format suggested. ... DataPtr ­ pointer to image data row. ... Collections.Generic; System.Windows.Forms; Microsoft.JScript; Microsoft.JScript.Vsa; Microsoft.Vsa; } return result; // Reading script from file public static string ReadScriptFromFile( string fileName) { System.IO.StreamReader sr = new System.IO.StreamReader(fileName); string sScript = ; try { sScript = sr.ReadToEnd(); } catch (Exception ex) { //TODO } finally { sr.Close(); } } return sScript ...

Еще в разделе: (Показать все результаты (>105) - imaging.cmc.msu.ru/ )

• View publication | Laboratory of Mathematical Methods of Image Processing

... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>20) - www.bukivedi.ru/ )

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example

... Magazine archive: electronic versions of last magazine issues in PDF format . Lomonosov Moscow State University . Russian Academy of Technological Science . ... PhD, professor A.E. Andreev (deputy editor-in-chief), . PhD, professor A.S. Strogalov (deputy editor-in-chief), . ... In the "Intelligent systems" magazine (published since 1996) the scientific achievements in the field of intelligent system's theory and applications, new information technologies and computer science are published. ...

Еще в разделе: (Показать все результаты (>81) - www.intsys.msu.ru/ )

• Usage
• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling
• Intelligent Systems :: Magazine :: Web archive :: Volume 12, issue 1-4, 2008

Линда Уильямс . Коммерческий план' . ... Ключевым моментом становится превращение сексуального удовольствия в товар и его фетишизация. ... Обращавшиеся к анализу фетишизма с различных - социо-экономической и психологической - сторон, Маркс и Фрейд сходились в том, что это самообман, при котором создатель фетиша не сознает, что сам снабдил его властью, которой и поклоняется. ... Уильямс Л. Фетишизм и визуальное удовольствие тяжелого порно: Маркс, Фрейд и "коммерческий план". ...

Еще в разделе: (Показать все результаты (>8) - psyberlink.flogiston.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости