... 2015 . ... Submit your article . ... Ph.D., Faculty of Philosophy, Lomonosov Moscow State University; assistant professor, Journalism and Media Education Department, Sholokhov Moscow State Humanitarian University. ... The primary task of this article is to analyze the reaction of public authorities to acts of terrorism on the example of the government of Spain after the tragic events of March 11 th , 2004. ... 119991, Room A-710, Shuvalovskiy building, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>158) - ee-journal.spa.msu.ru/ )

Solar proton anisotropy and dropout effects in the polar cap and auroral zone during period of the extended substorm activity Kuznetsov S.N., and Lazutin L.L. Institute of Nuclear Physics, Moscow State University, Vorob'evy gory, Moscow, 119899 Russia Abstract. ... Dropout effects of the proton radial distribution were found suggesting specific field line stretching inside the magneosphere trapping region during period of extended substorm activity. ... Fig 1. ...

Еще в разделе: (Показать все результаты (>264) - www.kosmofizika.ru/ )

• Index of /spravka/mag
• Index of /lazutin

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>11) - iconolat13.phys.msu.ru/ )

• Guidelines

... Vice-Dean, Physics Department, M.V.Lomonosov Moscow State University . Vice-Director, International Laser Center, M.V.Lomonosov Moscow State University . ... International Laser Center and Faculty of Physics . ... Radiophysics including Quantum Electronics . ... Victor Zadkov's current research interests are in the field of laser physics, interaction of laser radiation with matter, molecular dynamics of photoexcited molecules, coherent control, quantum optics and physics of quantum information. ...

Еще в разделе: (Показать все результаты (>80) - qilab.phys.msu.ru/ )

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>7) - tex.bog.msu.ru/ )

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>297) - higeom.math.msu.su/ )

• C*-algebras: Talks
• Publications (English)

... Second-year students classes . Introduction to Linux . ... 32-bit Microcontroller Programming . ... In the given practical special course we address user techniques for working with Linux OS; we study the interface of the command line in great detail, methods of automation and batch processing, composition of scientific articles as well as the specifics of software design by using in-built toolkit. ... Use of console interface of the command line, automation (bash scripts) . ...

Еще в разделе: (Показать все результаты (>23) - engineering.phys.msu.ru/ )

• Parallel Programming
• Circuit Diagnostics
• Noise Meter

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>164) - www.pereplet.ru/ )

• Catalogue of acient and medieval eclipses

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Individual SELEX products, aptamers, are small molecules (40ґ100 nt) that have a unique three-dimensional structure, which provides for their specific and high-affinity binding to targets varying from low-molecular-weight ligands to proteins. ... Selection of aptamers binding with a target is the key step in SELEX, as aptamers account for only a small fraction of the initial library (one aptamer per 109 to 1013 molecules) [6]. ... Fourth, modification can increase the aptamer affinity for a target. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf
• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf

X Workshop on Particle Correlation and Femtoscopy 25-29 August, 2014 Higher flow harmonics and ridge effect in PbPb collisions with HYDJET ++ model Czech Technical University in Prague SINP MSU, Russia V.L. Korotkikh, I.P. Lokhtin, S.V. Petrushanko, A.M. Snigirev SINP MSU Gyulnara Eyyubova, Project OPVK CZ.1.07/2.3.00/30.0034 1 Outline HYDJET ++ model (hydro + jet ) Description of elliptic flow v 2 Triangular flow v3 and higher Phys. Comm. ... HYDJET++ 31 ...

Еще в разделе: (Показать все результаты (>169) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/~igor/seminar/CorrFlow_In_AMPT_vlk.pdf
• http://lav01.sinp.msu.ru/~vlk/report97_monet.ps
• http://lav01.sinp.msu.ru/~igor/seminar/1108.0717_AMPT_Xu_Ko.pdf

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>175) - vestnik.math.msu.su/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>20) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/INFN%20-%20ANTARES.pdf

... CELL BIOPHYSICS Application of a Photosystem II Model for Analysis of Fluorescence Induction Curves in the 100 ns to 10 s Time Domain after Excitation with a Saturating Light Pulse N. E. Belyaevaa, V. Z. Pashchenkoa, G. Rengerb, G. Yu. ... In the case of weak measuring light, the steady-state level of fluorescence induction curve (Fig. ... The model of PSII predicted that, upon long (10 s) exposure to weak measuring light, the states with open RCs are being populated (Fig. 4, curves 3, 5 QA). ......

Еще в разделе: (Показать все результаты (>39) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3345.pdf
• http://library.biophys.msu.ru/PDF/3347.pdf
• http://library.biophys.msu.ru/PDF/3329.pdf

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>10) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.su/~yurin/Doxyfile
• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf
• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt3_inpaint_my.pdf

... The ringing detection method is based on finding the area where ringing effect is likely to appear and calculating the ratio of average edge-normal and edgetangential derivatives moduli in this area. ... In this work, we consider the problem of ringing effect detection and reduction in MRI images. ... After applying inverse Fourier transform, the frequency truncated data results in image with limited resolution and ringing effect near sharp edges. ... Edge width estimation. ... Basic edges detection...

Еще в разделе: (Показать все результаты (>129) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2011.OGRW.Yatchenko_Krylov_Nasonov.RingingMRI.en.pdf
• http://imaging.cs.msu.ru/pub/2009.Graphicon.Krylov_Nasonov.IntComb.en.pdf
• http://imaging.cs.msu.ru/pub/2012.PRIA.Nasonov_Krylov.EdgeMetrics.en.pdf

... 4) Percolation probability: [pic] , where L is linear size of lattice. ... The presence of obstacles in a system leads to: - increase of the critical concentration value; this effect grows with increase of the full area of obstacles and falls with increase of the linear size of ones. - increase of the critical exponent ( value; this effect increase with growth both of linear size of obstacles and of their full area. - increase of the growth rate of ...

Еще в разделе: (Показать все результаты (>66) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/poster-sessions.html
• http://acat02.sinp.msu.ru/presentations/morhac/ACAT2002_Morhac_ID142.pdf
• http://acat02.sinp.msu.ru/tut5.html

Sternberg astronomical institute activities on site testing programs review Victor Kornilov comprehensive/characterization/of/astronomical/sites > kislovodsk/russia/2010/october/4-9 > Introduction This presentation responds on our activity in 5 last years only, inspite of that in SAI site testing researches have been started many years ago. ... More detailed discussion is devoted to MASS and DIMM measurements processing, some additional effects which were taken in account in last year. ...

Еще в разделе: (Показать все результаты (>17) - site2010.sai.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... On this page we collect references to our resources, documentation and resources on other sites. All these data are very helpful for everybody who wants to learn practical quantum chemistry. Firefly (PC GAMESS) main page . ... ERG group wrote some articles about visualization: . ... Нет комментариев " Quantum chemistry information page " . ... Quantum chemistry information page . ... 2015 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>31) - erg.biophys.msu.ru/ )