... This technology presumes that blood sampling is performed by patient himself, the sample is spotted on a dry, as a rule, porous surface (filter paper, cellulose acetate membrane, etc.), and the posterior transportation to a laboratory, for example, by post in a standard or a special envelope. ... Under the dried blood spot technology using, the problem of the sample spotted volume determination remains one of the main practical questions. ... The problem is to find a function f (y1 , y2 , . ...

Еще в разделе: (Показать все результаты (>169) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/people/ssmirnov/astana.pdf
• Alexey Garber

... Another strong point of this model is that the participants can reach not only intellectual understanding but also an affective tolerance of cultural differences in the process of intercultural communication (Bennett, 1986). This training model also has its limitations. ... Many scholars and trainers argue that applying a single model of intercultural training may not sufficiently prepare participants to function properly and effectively in a new cultural environment (Chen & Starosta, 1998 : 267). ...

Еще в разделе: (Показать все результаты (>99) - www.prof.msu.ru/ )

• Some Ideas in Current Situation in our Country
• Conflict Transformation, Ngo And Networking
• NGOs: The Carriers of Globalization?

... The behavior of low-temperature hydrogen sensors based on the PbO 2 /heteropoly compound/Pt electrochemical cells, where heteropoly compound is H 4 SiW 12 O 40 *nH 2 O or MeH 3-x PW 12 O 40 *nH 2 O (Me = Li, Na, K, Rb, NH 4 , x=0,2,3), in H 2 -Ar and H 2 -air atmospheres was studied. All heteropoly compounds studied were shown to be electrocatalytically active in reactions involving hydrogen. ... Thus, based on the studies performed, we can choose the optimum design of the hydrogen sensor. ...

Еще в разделе: (Показать все результаты (>85) - electr003.chem.msu.ru/ )

POLARITY RULES IN COMPUTER DESIGN OF HETEROCYCLES E.V. Babaev Chemical Dept, Moscow State University, Moscow 119899, Russia Abstrac t Qualitative polarity rules for heterocyclic ring synthesis via polar reactions of cyclization or recyclization are discussed. The main idea is the application of general definition of consonant and dissonant structures to acyclic chains and cyclic heteroaromatics and analysis of interconversion of this two combinatorial properties. ...

Еще в разделе: (Показать все результаты (>154) - www.chem.msu.ru/ )

• http://www.chem.msu.ru/eng/misc/babaev/papers/151e.pdf
• http://www.chem.msu.ru/eng/lab/chemkin/chemkin-people/articles-pdf/vorobiev11.pdf
• Intuitive Chemical Topology Concepts

PHYSICAL REVIEW A 73, 063810 2006 Polarization states of four-dimensional systems based on biphotons Yu. ... Another disadvantage of using polarization qutrits rises from the fundamental impossibility to switch between arbitrary qutrit states using SU 2 optical elements, like retardation plates, rotators, etc. ... II we discuss the main properties of ququarts that are generated using the polarization state of the two-photon biphoton field. ... That subset of states was used to be reconstructed. ...

Еще в разделе: (Показать все результаты (>125) - qi.phys.msu.ru/ )

• http://qi.phys.msu.ru/papers/2009-jetp(e)-108-33.pdf
• http://qi.phys.msu.su/papers/2007-nato-11-123.pdf
• http://qi.phys.msu.su/papers/2006-jetp(e)-102-712.pdf

e-mail: viverhovin@yandex.ru) , , , corruption, the western enforcement system, corruption scandals, statistics of corruption in the western countries . ... Analysis and criticism of some apologetics examples of the western market society, not capable to minimize corruption at different levels of its organization is given. Necessary statistical and actual arguments in favor of the author's viewpoint are resulted. ...

Еще в разделе: (Показать все результаты (>43) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2013/4/09.pdf

... CENTRE FOR PHOTONUCLEAR EXPERIMENTS DATA . Online Services | Partners | ... Contacts | ... CDFE: Online Services . Inverse Geometry gives to one the possibility to obtain the data for different reactions with the same combination of incident particle and target nucleus, for example . ... in one request and for energy recalculated from LAB-system to SCI-system . ... If you have any questions, comments, and/or suggestions, please, contact . CDFE Head : Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>29) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

. Some individual experimental Cerenkov light LDF fits. Experimental pulse example. Differential energy spectrum. Tunka-25 energy spectrum among some other experimental data. Mean depth of EAS maximum with two different methods. EAS maximum depth distributions for two energies. Open histograms - experiment. Filled histograms - simulation for QGSJET-01 and complex composition.

Еще в разделе: (Показать все результаты (>13) - dbserv.sinp.msu.ru/ )

• 3d Map Description
• 1d Map Description

DVM debugger - contents . Part 1 (1 - 4) . ... Writing to read-only variable is detected. ... Using non-initialized element <elem> . ... Using variable <var> before asynchronous reduction competed . ... The dynamic debugger detects access to a shadow element before asynchronous shadow renew competed . ... It is reported when any non-correspondence of trace or loop description file is detected. ... Different values of reduction operation are detected for current event and in reference trace record. ...

Еще в разделе: (Показать все результаты (>103) - sp.cs.msu.ru/ )

• DVM-system. Goals and structure
• HPF DVM. Language specification
• Prefictor of DVM-program performance. User's guide

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

Unity in the name of the Higher School I.B. Fedorov, Chairman of Rectors' Council of Moscow and Moscow Region, Rector of Moscow State Bauman Technical University, Corresponding Member of Russian Academy of Sciences. ... They help to think anew those events, which are still extremely important many years later. ... Even more, inside the higher school itself, skeptical mood prevailed at that time - just another senseless organization to waste time and efforts. ...

Еще в разделе: (Показать все результаты (>32) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/396.doc
• http://www.rsr-online.ru/doc/norm/328.doc
• http://www.rsr-online.ru/doc/norm/327.doc

... 7.1] Lectures of prof. Scrucca in Advanced quantum field theory (e.g., for the first study of the worldline formalism): http://itp.epfl.ch/webdav/site/itp/users/181759/public/aqft.pdf . ... I. Topological quantum effects Lecture 1 (Spring 2015) , The Outline Before Casimir: the van der Waals forces (presentation, pdf) . ... Lecture 5 (Fall 2015) , Lattice field theory: 'free fields' (presentation, pdf) . Lectures 6-7 (Fall 2015) , Lattice field theory: 'interacting fields'. ...

Еще в разделе: (Показать все результаты (>10) - theorphys.phys.msu.ru/ )

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>44) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/res2007eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/dimm_specs.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>15) - tukachev.flogiston.ru/ )

• Category: Новости

... solvation nucleation of the polymorphs Solute-solute interactions, association parameters , thermodynamics parameters , conformations growth of the crystal Nature of solvent, intermolecular interactions (solute ­ solvent, solute-solute), conformations Lattice energy , entropy of the crystal, symmetry of the lattice, conformations The conformational manifolds is the candidate to be a coordinate of reaction Methods of investigations Quantum chemistry ...

Еще в разделе: (Показать все результаты (>16) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/probst.pdf
• http://www.elch.chem.msu.ru/mole/lecture/qprice.pdf

... 2 : 1 ­ , 2 ­ : 1 : 1) Define the subject of intercultural communication. What is the difference between intercultural and cross-cultural communication? ... 2) Define culture. ... Explain the role of metaphor in culture studies. ... 4) Enumerate the basic functions of culture. ... 13) Comment on the acute problems of intercultural communication in the modern Russian society 2 : 1) Was Edward Hall right to define communication as culture and culture as communication? ... 2) Define communication. ...

Еще в разделе: (Показать все результаты (>80) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/research/publications/komarova/komarova-the-earth-and-its-people.pdf

... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>6) - lab106.imec.msu.ru/ )

Appl Phys B DOI 10.1007/s00340-009-3463-6 Frequency-modulation spectroscopy of coherent dark resonances in 87Rb atoms Y.V. Vladimirova · V.N. Zadkov · A.V. Akimov · A.Y. Samokotin · A.V. Sokolov · V.N. Sorokin · N.N. Kolachevsky Received: 6 February 2009 © Springer-Verlag 2009 Abstract The results of frequency-modulation (FM) spectroscopy of coherent dark resonances from the Zeeman sublevels of the transition F = 2 F = 1of D1 line in absorption of 87 Rb atoms are presented and discussed in detail. ...

Еще в разделе: (Показать все результаты (>81) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/SPIE-4750-54-63(2002).pdf
• http://qilab.phys.msu.ru/papers/JCTE-2002-en.pdf
• http://qilab.phys.msu.ru/papers/SPIE-5128-37-46(2003).pdf

Geometric Structures in Integrable Systems Sergey Adzhiev (with Victor Vedenyapin), Entropy for generalised quantum kinetic and Liouville equations. Abstract: In his 1872 paper L. Boltzmann proved H-theorem for a class of kinetic equations. ... Abstract: P. Clarkson and M. Kruskal (1989) proposed a method for finding reductions of partial differential equations with two independent variables. ... Gennady El, Kinetic equation for a soliton gas ­ a new integrable system? ...

Еще в разделе: (Показать все результаты (>83) - new.math.msu.su/ )

... News . ... Main activities of the group relate to the nanophotonics and nano-optics of different types of nanostructures including metamaterials. ... Optical tweezers allow the manipulation and measuring the interaction forces of microscopic objects from single living cells to magnetic micro-particles in magnetic fluids. ... Submitted by Маруся_П on Wed, 03/09/2016 - 16:07 . ... Submitted by Маруся_П on Fri, 02/19/2016 - 15:02 . ... Submitted by Маруся_П on Thu, 02/18/2016 - 17:25 . ...

Еще в разделе: (Показать все результаты (>80) - nanolab.phys.msu.ru/ )

• Ultrafast plasmonics and magnetoplasmonics | Laboratory of Nanophotonics &