Research Interests . Main current projects: . The Continuous Wavelet Transform based on the solution of Partial Differential Equations and its applications . ... Mean-field description of Kinetic Aggregate's Growth and Disease Spead including Anomalous Diffusion. ... It is based on the reducing of this integral transform to the exact analytical representation as the series of the Bessel and Struve functions multiplied by the wavelet coefficients of the input function. ...

Еще в разделе: (Показать все результаты (>75) - chaos.phys.msu.ru/ )

... Master Education . ... Master programs . ... graduates for activities requiring in-depth fundamental and professional knowledge, including research in applied mathematics and computer technology, development and use of mathematical models for processes and objects, development and application of advanced mathematical methods and software to address problems in science, technology, economics and management.The Mathematical and Computational Methods of Image Processing ... master thesis...

Еще в разделе: (Показать все результаты (>18) - hcs.cmc.msu.ru/ )

• Master program "Enterprise Information Systems" | Магистерское и послевузовское
• Mathematical Models of Complex Systems: Theory, Algorithms, Applications |
• Master program "Information Security and Cryptography" | Магистерское и

... H: Ї 1 ґ Al2O3ґNa3AlF6 (T - x) = 1 , ґ , ґ 1 ( ґ ); Ї 1 ґ Na2SO4ґH2O (T - x) = 1 ( ); Ї 25° ( .. ... Na2SO4ґH2O Na2SO4 10H2O, Na2SO4 + 10H2O Na2SO4 10H2O. , , , . ... 6, 7) LiBr KBr, , : L LiBr() + KBr() . ... 1) , , KBr. ... L. PbTeґSnTe PbSeґSnSe PbTe PbSe, , (.. ... BeF2ґLiF , ( ), LiBeF3 Li2BeF4 BeF2ґLiF (. ... LiBeF3 280°, BeF2 Li2BeF4 : LiBeF3 () ґ Na2SO4 7H2O: Na2SO4 + 7H2O Na2SO4 7H2O. : Na2SO4 7H2O() Na2SO4 10H2O() Na2SO4 () Na2SO4 () +L 24° BeF2 () + Li2BeF4 () . ... Na2SO4ґH2O Na2SO4ґH2O....

Еще в разделе: (Показать все результаты (>42) - www.inorg.chem.msu.ru/ )

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>1096) - zmmu.msu.ru/ )

• Russian Journal of Theriology
• The distributions of telomeric and ribosomal DNA on the chromosomes of two
• Temporal and spatial distribution of Rad51 protein in spermatocytes of the

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>10) - iconolat13.phys.msu.ru/ )

• Program topics

... Data . ... The RELEC experiment was specially developed for study of relativistic electrons in near-Earth space together with TLEs in order to test possible connection between these two phenomena. RELEC mission includes x-ray and gamma-ray spectrometer, 3-axis detector for electrons, UV and red-light flash detector, fast optical imager, low-frequency and radio-frequency analyzers of electromagnetic field and waves. ... Electrons 570-850 keV . ... Gamma-rays 50-420 keV + Electrons 0.2-3.15 MeV . ...

Еще в разделе: (Показать все результаты (>29) - smdc.sinp.msu.ru/ )

• APEV service - Space monitoring data center
• RELEC - relativistic electrons

... Nonlinearity of Sound Wave Propagation and Stimulated Brillouin Scattering Process . A.I.Erokhin (Nonlinear Optics and Light Scattering Laboratory, Lebedev Physical Institute, Moscow, Russia) . ... Hypersound intensity in SBS process usually exceeds some kW/cm2 and is naturally expected to reveal nonlinear features. ... It causes the atypical acoustic nonlinearity appearance. ... New experimental approaches for investigation of intense hypersound propagation in liquids have been tried. ...

Еще в разделе: (Показать все результаты (>272) - acs366.phys.msu.su/ )

• Abstract (Invited)
• Schedule : Nonlinear Acoustics and Optics
• Nonlinear Acoustics and Optics

To see a Russian version of this page, click here . ... Graduated from Moscow State University (MSU), Faculty of Physics in 1976. Ph.D. degree - 1988, MSU. Main field of scientific activities: photometric investigations of various stars, close binary stellar systems and other astronomical objects, including research with use of fast photoelectric photometry with a high time resolution till 1 millisecond. ... New portable photometer . ... Send your mail to: tem@sai.msu.ru ...

Еще в разделе: (Показать все результаты (>15) - uranus.sai.msu.ru/ )

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Field stations . ... Educational council . Science . ... International commission on continental erosion . ... Field training . ... Type of field courses . ... Interuniversity council for erosion and fluvial.. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• ICCE events
• Department of Land Hydrology
• THE MAKKAVEEV LABORATORY OF SOIL EROSION AND FLUVIAL PROCESSES

Международный учебно-научный лазерный центр МГУ им. М.В. Ломоносова . ... Новости . О МЛЦ МГУ . Наука . ... Сотрудничество . ... Все новости . ... Конкурс-конференция на получение премии поддержки молодых ученых. Заявки до 25 октября 2015г. Семинар МЛЦ и кафедры . ... Главная Новости Наука . ... International Conference on Photo-Excited Processes and Applications. ... Другие новости категории: . ... Категория: Конференции . ... Категории: Наука , Сотрудничество . ... 2008 МЛЦ МГУ . ...

Еще в разделе: (Показать все результаты (>128) - ilc.phys.msu.ru/ )

• Laboratory of Nonlinear Spectroscopy of Ultrafast Processes in Condensed Matter
• Laboratory of ultrafast processes in biology
• Setup for high-resolution luminescence spectroscopy

... О физическом факультете . ... Помощь факультету . ССО факультета . ... Система электронного документооборота (СЭД) МГУ . ... Физический факультет . ... Наш факультет . Новости факультета . История факультета . Подразделения факультета . Выпускники факультета . ... Журнал "Ученые записки физич. факультета МГУ" . ... Научные семинары . ... Журнал "Ученые записки физического факультета МГУ" . ... Тема: 'Modeling and Control of Physiological Process: Towards Systems Medicine'. ...

Еще в разделе: (Показать все результаты (>156) - phys.msu.ru/ )

• "EURASIP Journal on Applied Signal Processing

... Географии мирового хозяйства . ... Рекреационной географии и туризма . ... Учебно-научные базы . ... Международное сотрудничество . ... Конференции, съезды, семинары . ... II Всероссийская конференция "География, общество, окружающая среда" . ... Географический факультет МГУ имени М.В.Ломоносова и Смоленский гуманитарный университет совместно с Ассоциацией геоморфологов России организуют международную конференцию "GEOMORPHIC PROCESSES AND GEOARCHAEOLOGY: From Landscape Archaeology to Archaeotourism"...

Еще в разделе: (Показать все результаты (>336) - www.geogr.msu.ru/ )

• CONTENT 1?(5)?2012
• Instructions for Authors, contributing to ?GEOGRAPHY, ENVIRONMENT,
• CONTENT 3а(8)а2015

RESOLUTION of the Research and Practice Conference "Modern approaches to the formation of legal basis of education" October 5, 2010. The participants of the Research and Practice Conference formation of legal basis of education", representing Russian institutions, research and development organisations, business legislative authorities of the Russian Federation, public orga missions held an open expert discussion of the draft federal Russian Federation". ... The principle of academic freedom. ...

Еще в разделе: (Показать все результаты (>39) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/396.doc

... More Reports . ... Variety of long-eared owls (Asio otus) diet, as index of habitat usefulness // Mobility of students and programmes flexibility in the prospect of the European unification of the training processes in ecology and environmental science. ... Long-eared owl A.otus rather actively masters anthropogenous landscapes. In this connection it is interesting to observe change of various aspects of ecology of this species, in particular, dynamics of its food objects. ...

Еще в разделе: (Показать все результаты (>57) - vertebrata.bio.msu.ru/ )

• Выступления студентов и аспирантов на конференциях
• Sergei V. Ogurtsov

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>14) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

Cell Biology International 27 (2003) 293ґ294 Cell Biology International www.elsevier.com/locate/jnlabr/ycbir Short communication Microtubule dynamics in living cells : direct analysis in the internal cytoplasm Ivan A. Vorobjev a a,* , Irina B. Alieva a, Ilya S. Grigoriev b, Gary G. Borisy c Laboratory of Cell Motility, A.N. Belozersky Institute, Moscow State University, Moscow, Russia b Department of ... These data demonstrate that MT growth is impeded at the cell margin. ...

Еще в разделе: (Показать все результаты (>25) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/komarova2002.pdf

... 1988) MERCURY Dollfus & Auriere(1974) Veverka et al. ... Lunar Crater name Ptolemaeus Bullialdus Gassendi crater maturity Im Is/FeO 1.452 68 1.451 68 1.415 75 Mercurian wavelength dependence of Pmax and lunar data 1,6 1 1,4 3 1,2 1 5 0,8 0,6 0,4 0,2 0 2,2 2,4 2,6 2,8 3 3,2 log l, (nm) Fig. 3 log Pmax, (%) 2 4 6 Conclusions: Maturity of the soil on the Mercurian surface in scale of whole disk is similar to space weathering of the soil in large old craters on the lunar highland. ...

Еще в разделе: (Показать все результаты (>90) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Symposium/sym-pap-a.doc
• http://selena.sai.msu.ru/Shev/Publications/ms38/ms085.pdf
• http://selena.sai.msu.ru/Ber/Publications/7305CorrectedProof.pdf

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>23) - observ.pereplet.ru/ )

. Print . Details . Written by Ольга Жулябина . Published: 29 November 2015 . Sorry, this page has no english version.

Еще в разделе: (Показать все результаты (>74) - engineering.phys.msu.ru/ )

• One day in a lab
• Parallel Programming
• Russia Today channel about us

... Finance for Start-Up . ... Инновационная . структура МГУ . ... Обучение инновационному менеджменту . ... деятельности . ... Process of Forming a Company . ... Typical business development & equity scenario . ... Unfortunately, there is no single type of financing appropriate for all start-up companies and no single path to accessing money. ... 2005 Управление инновационной политики . и организации инновационной деятельности . МГУ им. М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>34) - innovation.msu.ru/ )

• Process of Forming a Company - Discussion Question