... Data . ... Solar energetic particles . ... Solar flare database (RU) . ... Select the storm date: . Select storm intensity threshold: . ... Developed in 2007. Copyright €й 2007 - 2016 Skobeltsyn Institute of Nuclear Physics Moscow State University Feedback ...

Еще в разделе: (Показать все результаты (>22) - smdc.sinp.msu.ru/ )

... We developed an easy-to-handle experimental setup, which includes a laser diode operating in continuous wave and amplitude-modulated mode, multi-channel fiber optic probe and different physical models simitating skin bwith blood vessels. Using this experimental setup we measured the intensity of light for different light source-detector separations, different diameters, orientations and imbedding depths of the vessels. ... This comparison showed qualitative agreement of the results. ...

Еще в разделе: (Показать все результаты (>94) - ofvp.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

Sample Submission Form for Example Measurements In order to provide the best and most appropriate measurement/results, the customer is asked to please fill in the following form and enclose it with the sample. This form or equivalent information is required prior to the sample measurements. ... WITec can not provide specialised sample preparation. Measurement Goal: What's the goal of the measurement? ...

Еще в разделе: (Показать все результаты (>17) - nano.msu.ru/ )

... IPI program works with group of sounding curves (from 1 to 100) in one data file. ... If Type of Array is =+3 or +4, then: 7 line : Name of VES (from 1 to 8 symbols) 8 line : number of distances for this VES . 9 line : dV values (in mV or V) 10 line : I values (in mA or A) Examples of *.dtg file : Example 1 for stabilized current AMN array Bilibino-90, VES from 24.5 to 43.0. 1 2 lines - description of data profile 4 1 0 17 1 -3 S { VES number , KeyIP, ?ax.nAB, ...

Еще в разделе: (Показать все результаты (>70) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• Anis. Page2

Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>18) - foroff.phys.msu.ru/ )

Poligraphic complex (printing plant) - humanitarian aid from RRU to South Ossetia A.A. Tibilov State University The printing plant is intended to make a wide range of materials - textbooks, manuals, presentations, reports, informational and commercial printed matters. ... wide color range, surpassing that of offset printing; . ... simple operation and high reliability. [pic] Besides the printer, there is a digital color copier Duplo DPS850 (Japan) size A3, in the printing complex. ...

Еще в разделе: (Показать все результаты (>30) - www.rsr-online.ru/ )

Status of mTCA Slow Control development at CMS Petr Volkov Lomonosov Moscow State University Skobeltsyn Institute of Nuclear Physics, Russia 6/27/2015 P. Volkov SINP MSU 1 uTCA: Introduction MicroTCA® - open standard for fabric computer systems. MicroTCA systems are both physically small and non-expensive. ... Use PVSSII and the JCOP Framework to develop your control applications. These are the official CMS DCS developing tools. ... CMS_MTCA_HCALTR_CRATE1 CRATES.. ...

Еще в разделе: (Показать все результаты (>138) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/proceedings2015/Collider_Volkov.pdf
• http://qfthep.sinp.msu.ru/talks2011/Libanov_Neutrino.pdf
• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf

... 2000 December 15 . IC443's Neutron Star . ... Explanation: Using x-ray data from the orbiting Chandra Observatory along with radio data from the Very Large Array , a team of researchers has discovered evidence for a new example of one of the most bizarre objects known to modern astrophysics -- a neutron star . ... The core collapsed when the star, located a reassuring 5,000 light-years away in the constellation Gemini , exploded long ago. How long ago? ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 January 3 - Cas A Supernova Remnant in X Rays

... Development Growth and Differentation [Dev Growth Differ] . Common information . ... since 1950-12-01 till today . ... http://www.blackwellpublishing.com/jo.. ... 1950-12-01 . today . ... http://www.blackwell-synergy.com/loi/dgd . ... full-text . ... http://elibrary.ru/issues.asp?id=2535 . ...

Еще в разделе: (Показать все результаты (>1047) - journals.genebee.msu.ru/ )

• JCatalog - Different journal alphabetic indexes
• Different alphabetic indexes of JCatalog

... There is a distinction between buried soil and paleosol, even though the two overlap considerably. ... On the other hand, pre-Holocene paleosols in my area (southeastern Minnesota) don't look like buried soils, and are never recognized as such except by specialists. ... By this criterion, the pre-settlement alluvial soils of southeastern Minnesota are borderline paleosols, where they have been buried by sediments eroded from plowed fields. ...

Еще в разделе: (Показать все результаты (>149) - www.fadr.msu.ru/ )

• Untitled
• STUDYING POLICY DELIVERY SYSTEMS
• Abstracts

Irina IVANOVA Transformation of the Southeast Asian social and economic space in the process of integration of the region into the global information economy Introduction. ... Common problems are superconcentration of economic activity in overpopulated centers, poor transport access to peripheries and lack of national and global connectivity. ... The nodes of the spatial framework of the Malacca Strait economic region have hierarchical structure as global, regional, national centers (pic.6). ...

Еще в разделе: (Показать все результаты (>215) - www.geogr.msu.ru/ )

• ПУБЛИКАЦИИ В PEER-REVIEWED OPEN ACCESS JOURNALS OF INTERNATIONAL SCIENTIFIC
• ONLINE-QUESTIONNAIRE OPEN ACCESS PUBLISHING
• CONTENTS ?2 - 2009

The use of the external module Ab_An.dll Ab_An.dll file is an external module for the Gibbs program, and is designed to calculate the activity coefficients of the components of albite- anortite solid solution. ... A non-ideal model of albite-anortite solid solution, proposed in literature [1], is used in this module. ... Preparation of the System file To be able to use the module Ab_An.dll, you need to include a binary solid solution of albite and anortite into the System file, as you create it. ...

Еще в разделе: (Показать все результаты (>63) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/Electrum.doc
• http://www.geol.msu.ru/deps/geochems/soft/FAQ.txt
• http://www.geol.msu.ru/deps/geochems/soft/en/ZnS_FeS.doc

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>23) - tukachev.flogiston.ru/ )

• Coursera?s Computing for Data Analysis course on R
• Category: Новости

Commissioning and operation 8 Commissioning and operation General considerations In the following, general aspects of commissioning and operation are discussed, the transition from construction to operation is outlined and the resources required during this transition, as well as for full operation of the facility, are summarised. ... 8.3 User operation The European XFEL is conceived as a multi-user facility. ... The total amount of scheduled user beam time per year is expected to be 4,800 hours. ...

Еще в разделе: (Показать все результаты (>137) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/200809/Stodolsky_nuta.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/TristanDuPree.pdf
• http://nuclphys.sinp.msu.ru/conf/XFEL/XFEL-TDR_Chapter09_Project%20Management.pdf

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf

... Brown x26; Mussett The Inaccessible Earth 01 Introduction.pdf . ... Brown x26; Mussett The Inaccessible Earth 02 Chapter.pdf . ...

Еще в разделе: (Показать все результаты (>52) - ocean.phys.msu.ru/ )

• Index of /courses/geo/lectures-addons/
• Index of /courses/phys_tsu/lecture07/
• Index of /courses/geo/lectures-addons-11/

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>153) - www.pereplet.ru/ )

Lomonosov Moscow State University . ... Academic Programs . Academic Board . International Cooperation . ... Academic Departments Programs . ... Bulletin of Moscow University . ... Contact Us . Phone Email Directory . ... Phone: (495) 734 03 22 . Fax: (495) 932 88 67 . ... Phone: (495) 932 99 15 . ... Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University: . ... 2000 - 2016 Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>123) - ffl.msu.ru/ )

• About Us

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>46) - sn.sai.msu.ru/ )