... Davis Center for Russian Studies at Harvard University. The Center aims at developing of fundamental knowledge about Russia, its culture, and its institutions. The Center also examines Russia in its regional and historical context, and welcomes and supports the study of neighboring countries that have been either integrated with, or subordinated to, the Russian state at various periods in history, or whose experience poses intellectual problems similar to those of Russia. ...

Еще в разделе: (Показать все результаты (>41) - suny.msu.ru/ )

• Center on Russia and the United States :: News
• Центр по делам России и США :: Другие проекты в России

... about ERC . education . research . ... The Lomonosov Moscow State University (MSU) has been training specialists in nanotechnology, nanomaterials and nanosystems for nearly ten years . ... MSU Nanotechnology Education and Research Center (ERC) was established to consolidate efforts of MSU units aimed at research and development and true cross-disciplinary education in nanotechnology, nanomaterials and nanosystems. ... Fundamentals of Nanotechnology? was the first step in ERC?s activity. ...

Еще в разделе: (Показать все результаты (>66) - nano.msu.ru/ )

• Announcement about the admission to MSU Graduate School for a new Master?s
• Composite Nanomaterials Master?s Program | MSU Nanotechnology Education and
• Functional Nanomaterials Specialization | MSU Nanotechnology Education and

FemtoScan 001 - FAQ . Russian version . ... How to build a histogram for a part of image . ... How to copy and print files seen in Quick View . Quick View Parameters and other options . About Macros . ... Choose the command Parameters in the menu View or in the popup menu, which appears after pressing the right button of the Mouse. ... All the images seen in Quick View . ... QuickView] - Legend view, seen on the images of Quick View , number of images ( Show All Images ) . ...

Еще в разделе: (Показать все результаты (>212) - www.spm.genebee.msu.ru/ )

• DAC numbers
• COM-port initialization file format
• High resolution DACs numbers

... Snecma Moteurs (Groupe Snecma, France) . ... The Colloquium-458, organized by EUROMECH , will take place at Institute of Mechanics of Lomonosov Moscow State University (MSU) . ... The subjects of the Colloquium-458 cover important problems dealing with the verification of constitutive equations, the organization of experiments, the connection between microstructures and mechanical properties and the effective utilization of the modern FEM packages. ... France. ... S.-Petersburg State Techn. ...

Еще в разделе: (Показать все результаты (>4) - www.imec.msu.ru/ )

• Институт механики МГУ

CALL for PAPERS . September 29-October 2, 2005 Boston University, Boston, Massachusetts, U.S.A. The Central Eurasian Studies Society (CESS) invites PAPER and ROUNDTABLE proposals for the Sixth CESS Annual Conference, September 29-October 2, 2005, in Boston, Massachusetts. ... Paper and roundtable proposals relating to all aspects of humanities and social science scholarship on Central Eurasia are welcome. ... Deadline for Submission of Paper and Roundtable Proposals: April 1, 2005. ...

Еще в разделе: (Показать все результаты (>245) - www.prof.msu.ru/ )

• Internationalizing Education In Barnaul State Pedagogical University
• PROFESSIONALS FOR COOPERATION ASSOCIATION
• Membership

... Repertoire . ... The Early Music Theatre is an amateur studio. ... The Theatre's repertoire is based on the music of both Russian and European composers of 16th-18th centuries: "L'Amfiparnaso" - a madrigal comedy by O.Vecchi (Italy, XVI), belonging to comedy dell'arte genre, "The English Debute" - musical competition between British early 'elite Art' ("Fairy Queen" by H.Purcell, late 17th cent.) and contemporary 'vulgar' musical amusements ("Beggar's Opera" by J.Pepush, early 18th cent.) ...

Еще в разделе: (Показать все результаты (>8) - www.tsm-msu.ru/ )

... Manuscripts are classified in size into the three categories: . ... The most stringent requirements are imposed on manuscripts of the first category. ... Manuscripts of the second category should contain a representation of main results without excessive details in conclusions and proofs. ... Manuscripts should be prepared in electronic form using LaTeX 2.09 (see the instructions for manuscript preparation in electronic form) . ... The manuscript should be signed by its author(s). ...

Еще в разделе: (Показать все результаты (>176) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Vestnik
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Editorial

download:rn-080423 ]] . CompHEP . ... THE VERSION 4.5.0rc2 IS A TEST RELEASE! ... 4.5.0rc1: some tiny bugs in generated event files in LHE . 4.4.113: Temporary stopper for Latex generation for 2Б†’N, N>4 . ... 4.4.98: working symb_batch.pl with new option for parallel calculations . ... 4.4.91: Three bugs in generation of session.dat with s_comphep . ... 4.4.90: Several bugs in generation of session.dat with s_comphep . ... 4.4.96: CompHEP-ROOT interface, for histogramming only . ... News . ...

Еще в разделе: (Показать все результаты (>27) - comphep.sinp.msu.ru/ )

• faq [CompHEP]
• extra:main [CompHEP]
• news [CompHEP]

Modeling distribution of polymerized anions on the liquidus of the Na 2 O-SiO 2 system . In previous studies, we have presented a STRUCTON computer program designed for statistical simulations of molecular-size distribution of Si-anions in polymerized silicate melts ( Polyakov , Ariskin , 2008). ... in the Na 2 SiO 3 melt. ... Ariskin A.A., Polyakov V.B. Simulation of molecular mass distributions and evaluation of O 2- concentrations in polymerized silicate melts // Geochemistry International. ...

Еще в разделе: (Показать все результаты (>849) - geo.web.ru/ )

• Сайт Number Theory Web - Все о Геологии (geo.web.ru)
• COMAGMAT MODEL
• Seismic tomography of central Eurasia

... Model of IDEF0 standard can be presented as: BP IDEF 0 = < Q, L, DC , DDm > , where Q ­ number of diagrams in the model; L ­ number of decomposition levels; DC ­ context diagram; DD m , m = 2, Q ­ the detailed diagrams. ... Context diagram of the model can be presented as: DC = < b, qar , AR DC > , where b ­ block of the general business-process function; AR DC = {arkDC } , k = 1, qar ­ set of arrows, which are connected with the block b . ...

Еще в разделе: (Показать все результаты (>484) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc97269/eng.pdf
• Problem about a finding of number of families the locally periodic solutions

... Dmitriy V. Serdobincev Ph.D., Head of AIC Development and Organization, Volga Region National AIC Economics and Organization Research Institute. ... Ekaterina V. Kudryashova junior researcher, Volga Region National AIC Economics and Organization Research Institute. ... Tatiana A. Petrova junior researcher, Volga Region National AIC Economics and Organization Research Institute. ... The article presents the result of monitoring of the implementation of State program the Saratov region. ...

Еще в разделе: (Показать все результаты (>570) - ee-journal.spa.msu.ru/ )

Studying at MU Programs and degrees . ... Moscow State University provides a wide range educational services and educational programmes. ... International students are offered Bachelour (4 years full time) and Master programmes (2 years full time). A number of our faculties train both domestic and international students according to Bachelour and Master programmes with granting Bachelour and Master diplomas. ... Please, contact International Students Office for information on the topics offered. ...

Еще в разделе: (Показать все результаты (>76) - www.ied.msu.ru/ )

• International Office of Moscow University - About us

... a6blp : Замена hdd в ноуте. ... 1 Raw_Read_Error_Rate 0x000f 119 083 034 Pre-fail Always - 232103045 . 3 Spin_Up_Time 0x0003 099 099 000 Pre-fail Always - 0 . 4 Start_Stop_Count 0x0032 097 097 020 Old_age Always - 3179 . 5 Reallocated_Sector_Ct 0x0033 094 094 036 Pre-fail Always - 129 . 7 Seek_Error_Rate 0x000f 067 059 030 Pre-fail Always - 313879468641 . 9 Power_On_Hours 0x0032 079 079 000 Old_age Always - 18748 (245 201 0) . ...

Еще в разделе: (Показать все результаты (>12658) - www.fds-net.ru/ )

• Pink Floyd - The Wall DVD-version - Public forum of MSU united student networks
• ICQ number!? - Public forum of MSU united student networks
• nelly-"number 1" - Public forum of MSU united student networks

... 15 March 2002: Deadline for abstract submission . ... 1 June 2002: Deadline for advanced registration . ... For the advanced registration, the payment should be made by bank transfer to MI bank which is placed in Moscow. ... Registration fee for ISNA-16 from LAST NAME, INITIALS, COUNTRY " . Please note that the registration fee ($250 before June 1, 2002, and $300 after this date, $75 for students) does not include additional bank transfer fees that may be charged by some banks. ...

Еще в разделе: (Показать все результаты (>487) - acs366.phys.msu.su/ )

• Abstract
• Abstract (Invited)

... Screening pattern or alignment against protein databank . ... SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Unitary Dayhoff Blosum 30 Blosum 50 Blosum 62 Johnson . ... Pattern Alignment . Pattern (or alignment) . Pattern example 1: . ... FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>231) - www.genebee.msu.ru/ )

• Screening protein sequence against PROSITE databank
• Laboratory of protein-nucleic interactions (Russian version)
• BLAST Basic Overview

... Find the Brillouin zone for a 2D honeycomb lattice (lattice parameter d) and transform it into a hexagon. ... Compare the energies and the RMS charge radii electrons, in units of e). 1 2 (r )d3 x thus obtained ((x) is the total charge density of two 4. Find the density profile n(r) for an atom with the nucleus charge -Z e using the Thomas­ Fermi equation. ... Introducing the wavefunction (x) containing the low-energy degrees of freedom, find the effective wave equation for it. ...

Еще в разделе: (Показать все результаты (>12) - theorphys.phys.msu.ru/ )

... List of participants . ... Academician of NAS of Belarus, Professor, Institute for Problems of Natural Resources Use and Ecology . ... Professor, Laboratory of Geoenvironmental Science and Engineering, Cornell University . ... Professor, Dept. of Soil Science and Agrochemistry, Rostov State University . ... Senior Scientist, Dept. of Chemistry, Div. of Organic Chemistry, Lomonosov Moscow State University . ... Professor, Head of Soil Chemistry Chair, Dept. of Soil Science, Moscow State University . ...

Еще в разделе: (Показать все результаты (>204) - mgumus.chem.msu.ru/ )

• IHSS-14

... Site is discontinually updating by professional biologists and students of biology faculty of MSU. ... All Journals . This list contains all journals in JCatalog database. Select the letter and click it. If there is no action when clicking then no journals begins from this letter. Set the mouse cursor on any letter and you will know the number of journals; gray letter colour means that no journals begins from it. ... View whole journal list(1749) . ... Index | All journals . ...

Еще в разделе: (Показать все результаты (>215) - journals.genebee.msu.ru/ )

• JCatalog journal list

... Inorganic Materials Sciences . Chemistry of Coordination Compounds . ... Alyoshin V.A. Assoc. Prof. Dr. Sci. ... Prof. Ph.D. IS . ... Baranov A.N. Researcher . Ph.D. IMS . ... Berdonosov P.S. Senior teacher . ... Bobylev A.P. Senior researcher . ... Prof. Ph.D. CCC . ... Ph.D. CCC . ... Kazin P.E. Senior researcher . ... Kuznetsov A.N. Senior researcher . ... Lukashin A.V. Senior researcher . ... Odin I.N. Senior researcher . ... Prof. Ph.D. IMS . ... Shlyakhtin O.A. Senior researcher . ...

Еще в разделе: (Показать все результаты (>185) - www.inorg.chem.msu.ru/ )

• Prof. B.A.Popovkin Memorial page
• Head of the Inorganic Synthesis Laboratory prof. B.A.Popovkin
• Current Research Projects Grants

... Multi-threaded search engines . ... Unfortunately, most documents on search engines I saw in the Internet were either lists of hyperlinks without any comments, or discussions about how many documents are in the database of ... (here is the name of a search engine) and what method of counting of the number of documents was used. No words about the efficiency, i.e. how many documents on some subject I can find using this search engine, especially in comparison with the other ones. ...

Еще в разделе: (Показать все результаты (>5) - scon155.phys.msu.ru/ )