ERC Synergy Grant Call for Proposals Call Title: Call for proposals for ERC Synergy Grant Call identifier: ERC-2012-SyG Date of publication1: 25 October 2011 Electronic proposal submission deadline2 (single submission of full proposal): 25 January 2012 17.00.00 (Brussels local time) Indicative budget: EUR 150m from 2012 budget3. The final budget awarded to this call, following the evaluation of projects, may vary by up to 10% of the total value of the call. ...

Еще в разделе: (Показать все результаты (>33) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/guideline_third_country.pdf
• http://ideas.msu.ru/docs/CSA_guide_2008.pdf
• http://ideas.msu.ru/docs/CSA_call_2009.pdf

REGISTRATION FORM ----------------------------- NAME: SEX: DATE OF BIRTH: NATIONALITY: POSITION: AFFILIATION: E-MAIL ADDRESS: POSTAL ADDRESS: TELEPHONE: FAX: Dates of arrival/departure: Do you need Polish visa ? Do you wish to present a contribution ? Title of your proposed contribution: Abstract (1/2 page in text or tex format):

Еще в разделе: (Показать все результаты (>141) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/2004/ICME10-Proceedings.pdf
• http://higeom.math.msu.su/~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/1971/MathematicalNotes/Involution%20of%20manifolds%20with%20a%20set%20of%20fixed%20points%20diffeomorphic%20to%20real%20projective%20space.pdf
• http://higeom.math.msu.su/people/taras/papers/9910083.ps

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>7) - www.sciencepark.ru/ )

CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...

Еще в разделе: (Показать все результаты (>9) - astrometric.sai.msu.ru/ )

• Symbolic circuit processor
• Specification

... Recommended values . Start word length . Start length of motiff for Multiple sequence alignment. ... Max N Mismatches . ... Min score . ... Gap parameter . This parameter defines gap scoring. the grater this value is the stronger gap will be panalysed . ... If inforation content of a column is less than given value the column should be not included into alignment. the grater this value is the stronger gap will be panalysed . ... Max loop . Max energy of a helix . ... cgcatagctc cacca . ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

• SDPsite - PF07978
• SDPsite - PF01205
• SDPsite - PF01171

... The "Mulliken" AMMs up to the fourth order were calculated within the scheme developed by Saunders et al. [13] using the B3LYP, Perdew-Wang (PW91), and Perdew-BurkeErnzerhof (PBE) functionals with the 6-21G** basis set (for shortness, noted below basis set 3 or BS3) for all ALPOs, while the ATN and ATO structures were also considered at other levels as STO-3G (BS1), 3-21G (BS2), and 8-511G*(Al)/8-521G*(P)/8411G*(O) (BS4) for comparison. ... No EP convergence with the basis set was observed. ...

Еще в разделе: (Показать все результаты (>18) - beams.chem.msu.ru/ )

• http://beams.chem.msu.ru/sotrudniki/larin/CC_EF1f.doc
• http://beams.chem.msu.ru/sotrudniki/larin/PCCP1.pdf
• http://beams.chem.msu.ru/sotrudniki/larin/IJQC83.pdf

... 2 Measurement of PMTs counting characteristics and selection of op erating p oint To select the operating point of the PMT, that is the optimal values of the high voltage supply and pulse discrimination threshold, the command run counting=hv value is provided in the program mass. ... Starting with the minimum voltage (say 550 V) run command run counting=550 for the measurement execution. ... It is recommended to take measurements for the set of values of 0.4, 0.6, 0.8, 1.0. ...

Еще в разделе: (Показать все результаты (>18) - curl.sai.msu.ru/ )

... The two main ways of financing a business, equity financing and debt financing, will be discussed in this chapter. Equity Financing Equity capital is the amount of money that you and/or your partners put into the business or raise from other investors. Equity is not debt. While investors share in the profits (or losses) of the business, their investment is not a loan. ... Debt Financing With your equity capital in place, you are now in a position to approach lenders for a business loan. ...

Еще в разделе: (Показать все результаты (>24) - innovation.msu.ru/ )

• Start-Up Company Development :: Управление инновационной политики и организации

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... The Department of Operations Research . April 9, 2016 . Welcome Traditional topics of the conference Important dates Abstracts Registration . Final program Accommodation Program committee Organizing committee . ... V Moscow International Conference . on Operations Research, . ... Moscow, April 10-14, 2007 Important dates . ... Abstract deadline: December 20, 2006 . New deadline: January 10, 2007 . Notification of submission: February 1, 2007 . Create Date : 23.05.05 . ...

Еще в разделе: (Показать все результаты (>11) - io.cs.msu.ru/ )

... In addition to the direct effect of acidic solutions on tree crowns, resulting in tissue damage and leaching of metabolites, the acid impact modify soil properties, which is believed to be the most important in forest degradation. ... We assessed critical loads of acid deposition and their exceedance for forest soils in the European part of the former Soviet Union using a simple balance method and mapped them within 1.0°x0.5° longitude per latitude grid cells. ...

Еще в разделе: (Показать все результаты (>20) - eco.soil.msu.ru/ )

• CLEANSOIL, An innovate method for the on-site remediation of polluted soil

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>16) - imaging.cs.msu.ru/ )

• Imaging lab: people

... Детализация рейтинга: Sash . ... Zone . ... msu_td . ... Sash . ... Network . ... Forum . ...

Еще в разделе: (Показать все результаты (>8282) - www.snto-msu.net/ )

• Детализация рейтинга: filin - Public forum of MSU united student networks
• уж не знал куда это запостить - Public forum of MSU united student networks
• Детализация рейтинга: . - Public forum of MSU united student networks

... About Journal | ... The Editorial team's publication decisions are made based on the data reliability and the scientific value of the work despite the race, gender, nationality, citizenship, social position, religious or political views of the Authors. ... The Reviewer performs the impartial expertise of Author's materials. ... The Reviewer must notify the editorial team on any interest conflict with the Author, with the request for excluding him from the reviewing of the given manuscript. ...

Еще в разделе: (Показать все результаты (>35) - www.socio.msu.ru/ )

LIPSKIY-RODIONOVA' LUNAR ANTIPODES AS PRECURSORS OF A REGULAR WAVE PLANETOLOGY G.G.Kochemasov IGEM of the Russian Academy of Sciences, Moscow, Russia kochem@igem.ru / Fax: (009)(095)230 21 79 The first observations of the lunar far side allowed to compare it with the near side and draw very important conclusions in the very beginning of planetary studies based on spacecrafts. ... Celestial bodies are dichotomic. ... The concept of celestial bodies includes Sun (a star) as one of them. ...

Еще в разделе: (Показать все результаты (>78) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Symposium/lipskiy.pdf
• http://selena.sai.msu.ru/Bus/Publications/m44_14_busarev_etal.pdf
• http://selena.sai.msu.ru/Symposium/lun_net.doc

... The Sixth International Conference «Scientific Issues in Security and Combating Terrorism », Moscow, 11 - 12th of November, 2010 The Council of Europe approach to the international information security in the context of the fight against terrorism Ms. Marta Requena, Head of the Public International Law and Anti- Terrorism Division Head of the Counter Terrorism Task Force, Council of ... States certainly remain the principle actors of the fight against terrorism. ...

Еще в разделе: (Показать все результаты (>3) - www.iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2010/vaish_ea.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

. General Information . News . Organizing Committee . Program . Registration . Registered participants . Symposium expenses . Accommodation and meal . Important deadlines . Presentation information . Abstract submission . Cultural Program . Travel information . Contact information . 14 European Symposium on . Gas Phase Electron Diffraction . 24-28 June 2011 . M. V. Lomonosov Moscow State University . 1 February 2011 . deadline for Registration . 20 April 2011 . deadline for Abstract submission .

Еще в разделе: (Показать все результаты (>15) - ged.chem.msu.ru/ )

... Abstract A. V. Dmitriev, A. V. Ivanov, A. R. Khokhlov, Numerical simulation of light propagation through a diffuser, Fundamentalnaya i prikladnaya matematika, vol. 15 (2009), no. 6, pp. ... In this article, the light propagation in a diffuser with optically soft inclusions is described with the help of the Fokker--Planck equation, i.e., a transfer equation with a diffusion term in the space of radiation propagation directions. ... 8, 9] , x1 , : 1 D = (3 - x1 ), 6 3 x1 = 2 d x( )cos sin . ...

Еще в разделе: (Показать все результаты (>16) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/science/rec-GaN.pdf
• http://lizard.phys.msu.su/home/science/rec-GaN.ps.gz
• http://lizard.phys.msu.su/home/science/Dmitriev-Zvyagin-10-Uspekhi-final.pdf

... Главная -> Фильмы -> Important c'est d'aimer, L' . ... Фильмы . ... Important c'est d'aimer, L' . ... Jacques Dutronc . Claude Dauphin . ... Michel Robin . Guy Mairesse . ... Jacques Boudet . ... Jacques Jourdan . Claude Legros . ... Michel Such . Jacques Van Dooren . ... G?rard Zimmermann . ... Michel Berreur . Guy Delorme . ... Michel Duchaussoy . ... G?rard Moisan . ...

Еще в разделе: (Показать все результаты (>43) - kinfo.ru/ )

• Very Important Person - Фильмы - Kinfo.ru
• Important News - Фильмы - Kinfo.ru
• ?v?nement le plus important .. - Фильмы - Kinfo.ru