... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ‘GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY’ aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>253) - www.geogr.msu.ru/ )

МГУ имени М.В.Ломоносова Русская версия . ... Public and Municipal Administration . ... Public Relations and Theory of Communication . ... The section "Public Relations and Theory of Communication" based on an educational program "Advertisement and public relations" of Philosophical Faculty of MSU. The research supervisor of an educational program the head of "Philosophy of Language and Communication" department Kostikova A.A., the associate professor , candidate of philosophical sciences. ...

Еще в разделе: (Показать все результаты (>75) - conf.msu.ru/ )

• Anita - Dkhar / МГУ имени М.В.Ломоносова
• Nijat Nariman Nabiyev / МГУ имени М.В.Ломоносова
• Ульяна Антипова / МГУ имени М.В.Ломоносова

. Science . People . Education . News . For 1st and 2nd-year students . Introduction to quantum physics . FAQ . 2nd-year course work topics . About us . Contacts . En . Ru . Learn more about the special courses . Basics of quantum physics . FAQ . Information coursework 2 courses . 28 / October 2013 . Science . People . Education . News . For 1st and 2nd-year students . About us . Contacts . 2003 2016 Department of Quantum Electronics . +7 (495) 939-11-04 . chair@shg.phys.msu.ru . Войти

Еще в разделе: (Показать все результаты (>45) - quantum.phys.msu.ru/ )

• About us | Department of Quantum Electronics
• All news | Department of Quantum Electronics
• Contacts | Department of Quantum Electronics

... Study . ... SPDC Laboratory . ... Катамадзе К. Г. Управление частотно-угловым спектром бифотонного поля (2013). Download: 2013-7-k_g_katamadzje.pdf (8.1 MB) . Страупе С. С. Корреляционные свойства квантовых состояний высокой размерности на основе бифотонных полей (2011). ... Управление спектром пространственных мод бифотонного поля (2014). ... Управление частотно-угловым спектром бифотонного поля (2014). ... Патерова А. В. Управление спектром бифотонного поля за счет угловой дисперсии (2013). ...

Еще в разделе: (Показать все результаты (>80) - qi.phys.msu.ru/ )

• LabSite Error :: Quantum Information Laboratory

... Т-система -- среда программирования с поддержкой автоматического динамического распараллеливания программ. <http://www.botik.ru/~t-system> . ... М.: Мир, 1993. ... Sisal -- A High Performance, Portable, Parallel Programming Language. <http://www.llnl.gov/sisal/SisalHomePage.html> . ... The Cilk Project. <http://supertech.lcs.mit.edu/cilk> . ... Glasgow Parallel Haskell. <http://www.cee.hw.ac.uk/~dsg/gph> . ... Recursive functions algorithmic language. <http://www.refal.net> . ... 2000-09-12 ...

Еще в разделе: (Показать все результаты (>4) - cluster.msu.ru/ )

• Т-языки

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>5) - www.bio.msu.ru/ )

Summary of SUNY/MSU Center Activities . ... May 11, 2000: First meeting of the Board of Directors, SUNY Center on Russia and the United States. ... After some discussion, it was decided that SUNY and MSU would collaborate on the offering of three new SLN courses for spring 2001: Doing Business in Russia (SUNY Oneonta and MSU Faculty of Foreign Languages); Russian studies (SUNY Cortland and MSU Faculty of Foreign Languages), American studies (SUNY Buffalo and MSU Faculty of History). ... suny-msu . ...

Еще в разделе: (Показать все результаты (>21) - suny.msu.ru/ )

• Центр по делам России и США :: Публикации
• Center on Russia and the United States :: Links

... Please be careful while filling the information. All fields labeled with * must be filled. Be careful writing the second name and e-mail address. The procedure of login/password recovery will be impossible without exact spelling of these fields. If you can be available as a reviewer, please turn on the button in the appropriate section. First name . Second name . ... E-mail address . ... Available as a reviewer? ... Enter preffered user name . ...

Еще в разделе: (Показать все результаты (>1108) - zmmu.msu.ru/ )

• Russian bat research group

... доклад(продолжение) . ... Серега Павлюченко . доклад . ... Серега Карпов . ... Заслушивание предварительно подготовленных докладов и их обсуждение, а также треп на отвлеченные темы и распитие спиртных напитков . ... Требования к докладу . ... Присутствовать на докладе . ... Не присутствовать на докладе . ... Пить пиво Секретарь семинара - Серега Карпов (надеюсь, никто не против?) ...

Еще в разделе: (Показать все результаты (>367) - xray.sai.msu.ru/ )

• The COOC Criterion (Criterion of Observations versus Calculations)
• Banknotes at SunSITE Czech Republic

... Improvement of Java type compiler using in language independent remote process calls in KBase project. 09/2011 ­ present: Moscow State University, Dept. of Bioengineering and Bioinformatics (Russia) Scientific Research Java developer and lecturer Enhanced the CAMPS web resource (http://webclu.bio.wzw.tum.de/CAMPS2.0/) that enables multiple classification of transmembrane proteins. ... Developed web based UI for visualization of a graph of transmembrane protein families. ... Sutormin RA, Mironov AA. ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

Unfortunately, the English version of our site is much less developed than the Russian version. ... Library of Electronic Publications . ... The Institute for Time Nature Explorations web site is established by the Russian Interdisciplinary Temporology Seminar , which has been operating at M. V. Lomonosov's Moscow State University since 1984. The creation and continued maintenance of the institute were and are made possible through the support of the Russian Fund of Basic Research, grant No. ...

Еще в разделе: (Показать все результаты (>398) - chronos.msu.ru/ )

• Home - Institute for Time Nature Explorations
• Institute Laboratory-Chairs
• Барр Джеймс

INTERNATIONAL CONFERENCE . February 26 - March 05, 2006, Moscow, Russia . ... Moscow State University . Institute of Mechanics of MSU . ... It follows the tradition of biannual confer-ences organized by the Institute of Mechanics of Moscow State University between 1976 and 2004 (see http://hit2003.narod.ru/ ), which were widely attended by scientists and students from the former Soviet Union. ... Phone, E-mail and Fax. ... Institute of Mechanics, Moscow State University . ...

Еще в разделе: (Показать все результаты (>16) - hit-conf.imec.msu.ru/ )

• Nonlinear Problems of Gydrodynamic Stability Theory
• Untitled

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>197) - www.genebee.msu.ru/ )

• Импакт фактор научных журналов в 2003 году
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee BLAST 2.2.8 Services

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . ... Вакансии . ... Learning and Understanding HP and 3rd party software solutions, including architectures, development practices, frameworks, methodologies, SDK's, additional programming languages and tools as necessary, etc . ... Development of test plan, unit tests, integration, system and acceptance tests, basing on functional specification and user requirements, architectures, development schedules and project plans . ...

Еще в разделе: (Показать все результаты (>83) - www.physcareer.ru/ )

• Онлайн-курс "Взаимодействие компьютерного оборудования и программного

... Форумы > Аспирантура > Тема . ... Форумы Список тем Новая тема . ... Аспирантура ин-т Макса Планка / ун-т Заарланда, Германия . ... http://flake.cs.uiuc.edu/~titov/ . ... http://www.mmci.uni-saarland.de/ . ... http://cs.uni-sb.de/ . ... http://www.mpi-inf.mpg.de/ . ... http://www.dfki.de . ... http://www.mpi-sws.org . ... http://www.coli.uni-saarland.de/ . ... http://www.saarbruecken.de/en/home . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>401) - www.mmonline.ru/ )

• MMOnline | Форумы | Разное | Бабло
• MMOnline | Форумы | Абитуриентам | Артикли a, the
• MMOnline | Форумы | Аспирантура | Аспирантура (DPhil) в Оксфорде,...

В докладе изложены некоторые принципы моделирования языков-посредников для космического контакта Разумных и высокоорганизованных систем И.М.Крейн . При рассмотрении языка-посредника с позиций системологии Г.П.Мельникова, "надсистемой" для данного языка-посредника (ЯП) естественно считать пару систем-коммуникантов, вступающих в контакт. ... Разработка типологии систем-коммуникантов позволяет исследовать понятие "идентичных" (с точки зрения возможностей установления контакта) коммуникантов. ...

Еще в разделе: (Показать все результаты (>172) - lnfm1.sai.msu.ru/ )

• http://lnfm1.sai.msu.ru/SETI/koi/bulletin/6/pril1_9.html
• http://lnfm1.sai.msu.ru/SETI/koi/bulletin/2/pril3.html
• Trip over old Shanghai

Contents Curricula, and Programs. Mathematical Analysis. (The Program of Mathematical Physics Department).............................................. Algebra and Analytical Geometry.(The program of (General "Mathematics" Department)................................ Computer and Programming. (The program of Algorithmic Languages Department).................................... The practical work on Computers.( Department of Algorithmic. Languages)............................................... Discrete

Еще в разделе: (Показать все результаты (>6) - mph.cmc.msu.ru/ )

Dmitri A. Timashev Torus actions of complexity one Let T = (Cв )r be a complex algebraic torus acting on an algebraic variety X . ... By Sumihiro's theorem X = Xi is covered by finitely many affine open T -stable subvarieties. ... The normal affine T -varieties of complexity 1 are in a 1­1 correspondence with the hypercones. ... Conclusion: Normal T -varieties of complexity 1 are in a 1­1 correspondence with finite collections of hypercones intersecting in their common hyperfaces, called hyperfans. ...

Еще в разделе: (Показать все результаты (>146) - higeom.math.msu.su/ )

Information Extraction and Integration from Big Data (Web, Social Media, Texts, ...) . ... Hadoop, Map/Reduce. IBM BigInsights. : · · , ; (entities) ( , , , , .) AQL; , (matching) (resolution) (linking), (deduplication) (entity resolution); () , , ( , , ); , . ... HIL (Highlevel Integration Language, , IBM, Map/Reduce), AQL, . http://synthesis.ipi.ac.ru/synthesis/student/BigData), « - » « ». ...

Еще в разделе: (Показать все результаты (>2) - master.cmc.msu.ru/ )

Revealing and comparing regulons of homologues transcription factors UxuR and ExuR in Escherichia coli. ... Bioinformatic analysis of the genes regulated by UxuR and ExuR suggested similar targets for their binding with promoter DNA (4). ... Both uxuR and exuR expression was suggested to be dependent on the carbon source (4). ... ExuR binding to the targets was not as much dependent on the carbon source as for UxuR. ... Entner-Doudoroff metabolism in Escherichia coli. ...

Еще в разделе: (Показать все результаты (>264) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/47.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/49.pdf