Summary Progress Report 2010 ґ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>51) - fgp.msu.ru/ )

... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...

Еще в разделе: (Показать все результаты (>32) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/res2007eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/dimm_soft_description.pdf
• http://curl.sai.msu.ru/mass/download/doc/sv_ug.pdf

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>66) - cosmos.msu.ru/ )

Geometrical core (core) is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chains. ... Minimal core size (#aa's) . ... Alternative core new atoms (%) . ... Geometrical core is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chain. ... Each input sequences is aligned to the corresponding sequence obtained from the ATOM section of the protein chain in the PDB file. ...

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Alignment example
• Example of alignment
• NPG-explorer

... importance of terms such as 'geosols', 'paleosols' etc with interest. ... new zealand perspective is similar to that of Dr Crook of Australia - the . ... Some Quaternarists in New Zealand use 'buried soil' instead of buried . paleosol and the distinction is one of preference in the end (e.g Almond . ... I use the simple definition of a paleosol as a soil of a past landscape or . ... paleosols, and exhumed paleosols. ... surface' or 'non-buried' paleosols because these soils are clearly in the . ...

Еще в разделе: (Показать все результаты (>140) - www.fadr.msu.ru/ )

• http://www.paleopedology.msu.ru/discussions/messages/84.html
• Report from the Secretary
• Proposition

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Main Practical Applications Seen At Present Reactor Monitoring Ї In case of accident and no access into reactor , neutrino detector can follow state of nuclear reactions Ї Neutrino energy sp ectrum can determine comp osition of fissile materials and so indicate illegal use for b omb materials Geological Studies Search for mineral, fuel dep osits DIFFICULTIES I Neutral Current Detector sees all neutrino typ es I I ... Or consider detectors not resp onding to e/ background, like COUPP...

Еще в разделе: (Показать все результаты (>122) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/thgr/eng/ch5.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Konstantinova.pdf
• http://nuclphys.sinp.msu.ru/conf/XFEL/XFEL-TDR_Chapter08_Commissioning-Operation.pdf

M.H. Shulman, 2006 Michael H. Shulman TIME AND QUANTUM BEHAVIOR The paper presents an abstract of my talk at the Russian Interdisciplinary Temporology Seminar (23 of May, 2006th ). ... The following statements are argued: Ї The World time-space structure including its relativistic features are due to the quantum object features. Thanks to de Broglie we understood that each quantum object corresponds with some wave. ... A mathematic "exotics" of the quantum physics consists in two components. ...

Еще в разделе: (Показать все результаты (>329) - chronos.msu.ru/ )

• A. P. LEVICH, A. V. SOLOV?YOV. CATEGORY-FUNCTOR MODELLING OF NATURAL SYSTEMS
• A METHOD FOR DETERMINING ECOSYSTEM NORMAL FUNCTIONING REGIONS
• Collection of Temporology Screen Savers

... Take latest Pacman and install it : Create somewhere directory software/ and simply untar Pacman there : cd software wget http://physics.bu.edu/pacman/sample_cache/tarballs/pacman-latest.tar.gz tar xzf pacman-latest.tar.gz # It will be created, for example, directory pacman-3.21/ rm -f pacman-latest.tar.gz ln -s pacman-* pacman cd pacman source setup.csh # or setup.sh cd .. ... For instance, if you do pacman -allow tar-overwrite this setting remains as a default until you change it. ...

Еще в разделе: (Показать все результаты (>10) - lhe.sinp.msu.ru/ )

... Robert Hermann Brookline, MA (Received November 22, 1999) der to illustrate the obvious progress, one can mention a variety of examples. ... In or- FYI Item "BMS Report on Institutes" As a member of the panel commissioned by the Board on Mathematical Sciences of the National Research Council, I write to correct several inaccuracies in the "For your information" note by Allyn Jackson entitled "BMS Report on Institutes" in the December 1999 issue of the Notices. ...

Еще в разделе: (Показать все результаты (>60) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/IJBC_3body_problem.pdf

... David Kirk/NVIDIA and Wen-mei W. Hwu , 2007-2012 ECE408/CS483, University of Illinois , Urbana-Champaign 14 CUDA Device Memory Management API functions Ї cudaMalloc() ґ Allocates object in the device global memory ґ Two parameters Ї Address of a pointer to the allocated object Ї Size of of allocated object in terms of bytes ( Device ) Grid Block (0, 0) Block (0, 1) Registers Registers Registers Registers Ї cudaFree() ґ Frees object from ...

Еще в разделе: (Показать все результаты (>5) - ccoe.msu.ru/ )

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>66) - scon155.phys.msu.su/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>59) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• Anis. Page2

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>21) - tukachev.flogiston.ru/ )

• Category: Новости

... Acoustic Emission and Seismic Emission Monitoring of the Foundation of Hydroelectric Power Station Located on Soft Soils . ... If elastic waves are to be propagated in a medium with inhomogeneities (localized defects, stratification, cracks) the characteristics of the information signal, for example, velocity of propagation, amplitude, and spectral contents, can change their parameters [1]. ... These characteristics are processed with a specially developed algorithm. ...

Еще в разделе: (Показать все результаты (>121) - acs366.phys.msu.su/ )

• Abstract (Invited)

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>31) - www.sciencepark.ru/ )

• MSU Science Park - Venue & Space
• MSU Science Park - Services
• MSU Science Park

... help . find changesets by author, revision, files, or words in the commit message Working with Phases What are phases? ... Each changeset in a repository is in one of the following phases: - public : changeset is visible on a public server - draft : changeset is not yet published - secret : changeset should not be pushed, pulled, or cloned These phases are ordered (public < draft < secret) and no changeset can be in a lower phase than its ancestors. ... See "hg help -v phase" for examples. ...

Еще в разделе: (Показать все результаты (>13590) - kodomo.fbb.msu.ru/ )

• allpy: sandbox/wx-dc.py diff
• Help: config

... Basic Linux . ... PCMCIA . Sound . ... CLEVO 8750 running X Window . ... BIOS: Phoenix (256Kb Flash ROM, PnP 1.0a, APM 1.2, LBA) LCD: TFT 13.3" 1024x768 . ... PCMCIA: GL9382; 2x Type II or 1x Type III PC Card slots (with ZV support) . ... Battery: Ni-Mh or Li-Ion . ... Nor X Window neither PCMCIA worked. ... For CLEVO 8750, I found at least two RRs at which X Window works: 62Hz and 70Hz. ... To enable the mouse when working on console use GPM with "-dev/psaux -t ps2" options. ...

Еще в разделе: (Показать все результаты (>9) - uranus.sai.msu.ru/ )

... The Science Operation Department is composed of Astronomers, Telescope Instruments Operators(TIOs) and Data Handling Administrators(DHAs). ... Astronomers have proposed several methods to quantitatively measure the amount of turbulence above the telescope, which the most common ones is Differential Image Motion Monitor (DIMM). In optical testing, the Hartmann test is the common method to test the quality of optical components. ... Hartmann mask consists of 48 lenses. ...

Еще в разделе: (Показать все результаты (>23) - site2010.sai.msu.ru/ )

• Results of recent and ongoing site programs

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>90) - comphep.sinp.msu.ru/ )

• news [CompHEP]
• tutorials [CompHEP]
• extra:model:main [CompHEP]