... Data . ... Services . ... Solar energetic particles . ... N -d SW Conditions : Time profiles of the key geomagnetic ( Ap and Dst indices), solar wind (velocity V , density n and temperature T ) and IMF ( B , Bx , By , Bz in GSM) parameters observed in the N day vicinity of the geomagnetic disturbed day. N -d Map of Solar Events : Map of solar surface events occurred within N day vicinity of the moment when the solar wind expansion (which causes the geomagnetic event) started. ... WIND . ...

Еще в разделе: (Показать все результаты (>20) - smdc.sinp.msu.ru/ )

• AP8/AE8 model - Space monitoring data center
• ShielDose2 model - Space monitoring data center
• Space monitoring data center

... The pap er presents a metho d of finding the disp ersion diagrams, and an inequality for the numb er of mo des, linking the numb er of mo des with the top ological prop erties of the system. node H closednode 1 Introduction cell w1 p1 w2 p2 w3 p3 input terminals opennode Consider an infinite periodic set of tubes filled with compressible lossless linear gas (or liquid). ... The tubes are connected with each other by small nodes. ... There can be dead ends (i.e. closed nodes), or open nodes. ...

Еще в разделе: (Показать все результаты (>40) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/perehody.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/cone_asymptotics.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/dd03proc.pdf

... What is the author's opinion on the problem? ... Organize the following parameters into 3 groups: content, organization, presentation (performance) Ї Body-language and eye contact Ї Fluency Ї Proper intonation and pronunciation Ї Relevant information and examples provided Ї Conclusion Ї Key concepts explained\defined Ї A range of complex grammatical structures and academic vocabulary Ї Key points emphasized Ї Introduction Ї Various linking devices, the transition from one point to the ...

Еще в разделе: (Показать все результаты (>19) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/section4.pdf
• http://www.eng.math.msu.su/download/Academic_English_part1.pdf
• http://www.eng.math.msu.su/download/Midterm_test.pdf

... Robert Hermann Brookline, MA (Received November 22, 1999) der to illustrate the obvious progress, one can mention a variety of examples. ... In or- FYI Item "BMS Report on Institutes" As a member of the panel commissioned by the Board on Mathematical Sciences of the National Research Council, I write to correct several inaccuracies in the "For your information" note by Allyn Jackson entitled "BMS Report on Institutes" in the December 1999 issue of the Notices. ...

Еще в разделе: (Показать все результаты (>64) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/Zemskov+Loskutov_EPJB_2011.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/Nonli_phen_Compl_Systems.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/JSPstadium(t).pdf

... Revision Log Mode: Stop on copy Follow copies Show only adds and deletes View log starting at and back to . ... edit) . ... 5 years . me.dendik . ... Added rule to evade trapping yourself while eating for e4 snake . ... Added "run mostly forward" rule to e2 snake . ... Changed display names in e2, e4 snakes (they were both Example тАж . ... e4 snake now tries to zig-zag . ... Added two smarter snakes: e2 and e4 . ... snakes added . ... Added example empty snake . ... Added example snake . ...

Еще в разделе: (Показать все результаты (>384) - kodomo.cmm.msu.su/ )

• Preferences: Date & Time тАУ Tanchiki
• Preferences: Date & Time тАУ Petri Dish
• Preferences: Date & Time тАУ Cyclyc Cell Automata

Geology at Moscow State University . ... In 1804 the Chair of Mineralogy and Rural Home Economics was established at the Department of Physical and Mathematical Sciences. ... Geological education at Moscow State University is an important link in the whole system of higher education of the Russian Federation, and being the major educational and scientific centre of the country the Geology Faculty coordinates the work of other academic universities in the field of geological education. ...

Еще в разделе: (Показать все результаты (>57) - www.geol.msu.ru/ )

• Faculty of Geology >> Departments
• Download Yuri Shvarov's files

... Master Education . Second Education . ... Entrance requirements . ... personal statement addressed to the rector of MSU, containing the post-graduate course title and masters? program name . ... All applicants for full-time course (Russian students, both on scholarship and contract) are subject to following examinations: . ... All applicants to evening courses take an oral examination in the field of expertise. ... Второе высшее образование: second_edu@cs.msu.ru, 6-й этаж, комната 640, тел. ...

Еще в разделе: (Показать все результаты (>11) - hcs.cmc.msu.ru/ )

• Mathematical Models of Complex Systems: Theory, Algorithms, Applications |

... N.B. Gusev group . ... Special curses . ... The following special courses are delivered to the students of Department of Biochemistry: . ... Special chapters of Enzymology (staff of the Department of Biochemistry) . ... Graduates of 2011 year . Graduates of 2012 year . Graduates of 2013 year . ... Graduates of 2010 year . Graduates of 2009 year . Graduates of 2008 year . Graduates of 2007 year . Graduates of 2006 year . Graduates of 2005 year . Graduates of 2004 year . ...

Еще в разделе: (Показать все результаты (>58) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Na,K-ATPase and its role
• Biochemistry Department of Moscow State University | Regulation of muscle

... APPLICATION OF LASERS FOR INFORMATION STORAGE AND PROCESSING The Information Capacity of the L- System ґ Photon Field Channel B. A. Grishanin and V. N. Zadkov Physics Faculty and International Laser Center, M.V. Lomonosov Moscow State University, Vorob'evy gory, Moscow, 119899 Russia e-mail: grishan@comsim1.phys.msu.su e-mail: zadkov@comsim1.phys.msu.su Received ... If the quantum channel is noisy, the output state is a ^ ^ linear transform of the input state: out = C in . ...

Еще в разделе: (Показать все результаты (>72) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/LasPhys-2001-11(12)-en.pdf
• http://qilab.phys.msu.ru/papers/JCTE-2002-en.pdf
• http://qilab.phys.msu.ru/papers/PRA-2000-61-52305-en.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Dear book contributors of the NATO ARW, . following the ARW workshop the organizing committee has agreed to the following procedure in order to expedite the process of preparation, distribution and review of the individual manuscripts: . ... The manuscripts received will be sent by Norbert Hertkorn (GSF-Germany) and Irina Perminova (MGU/Russia) for review, typically to two different other authors which also have been participants of the NATO ARW, or to the independent appropriate reviewers. ...

Еще в разделе: (Показать все результаты (>119) - mgumus.chem.msu.ru/ )

• Humates NATO ARW Home Page

... Seminar archive . ... Type Ia Supernovae (SNe Ia) have an important role to measure a distance to an anonymous galaxy because they have a good correlation of the decline rates of the light curves with the absolute luminosity. ... First, super-Chandrasekhar SNe which have extremely high luminosity, slow decline rate of the light curves, slow expansion velocity and strong carbon features. ... As another example of diversity of SNe Ia, I would like also to introduce Type Iax SNe. ... All seminars: . ...

Еще в разделе: (Показать все результаты (>20) - master.sai.msu.ru/ )

• SAI Space Monitoring Laboratory

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>155) - www.pereplet.ru/ )

Preconcentration Laboratory . Laboratory of Chromatography . ... Laboratory of Kinetics Methods of Anaysis . ... Sorption-spectroscopy methods for determination of organic . ... Room-temperature ionic liquds, computational chemistry . ... New detection methods in ion and ion-pair chromatography . ... For that purpose, methods of selective preconcentration are developed along with the methods of determination of analytes directly in the sensing film or in the permeate after membrane diffusion. ...

Еще в разделе: (Показать все результаты (>26) - analyt.chem.msu.ru/ )

... In this case both the medium and the electric field depend on two space coordinates only. ... The classical modeling presentation is in apparent resistivity which reflects an electric field distribution on the earth's surface. ... An expression can be derived for the potential value in point M ([pic]): [pic], (4) where [pic] is the potential of the primary electric field, [pic] is the potential of the secondary electric field, defined by the surface charge distribution. ... pic] |[pic] | ...

Еще в разделе: (Показать все результаты (>62) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

ISSN 1560-3547, Regular and Chaotic Dynamics, 2015, Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 703 Then the system under study equation): 1 = = 2 3 = takes the following form (we deleted two multipliers from every (F (2 )+ F (3 ))1 (-1+2F (3 ) - 1 2 ), (F (3 )+ F (1 ))2 (-1+2F (1 ) - 2 2 ), (F (1 )+ F (2 ))3 (-1+2F (2 ) - 3 2 ). ... Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 709 function, the system takes the form (4.2). ...

Еще в разделе: (Показать все результаты (>123) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/283/149-gauss-principle-and-realization-of-constraints_en.pdf
• http://ics.org.ru/upload/iblock/4d3/110-kovalevskaya-exponents-and-poisson-structures_ru.pdf
• http://ics.org.ru/upload/iblock/4bf/191-the-bifurcation-analysis-and-the-conley-index-in-mechanics_ru.pdf

... The linguistic aspects of the model and the properties of the semantic dictionary ensuring the content analysis with compression of the text structure are considered. Our dictionary resources serve an instru- ment for building a multilevel textual semantic structure. ... Reason (A,B), where SemF(A) = SIT or a whole semantic formula; the same for SemF(B). ... Sem(SIT)R . ... Semantic Resources for Textual Content Compression // Fourth International Conference on Meaning-Text Theory (MTT'09). ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Lexical Resources for Personal Data Recognition in Texts

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>30) - www.sciencepark.ru/ )

• MSU Science Park - Venue & Space
• MSU Science Park - Services
• MSU Science Park

О лаборатории . ... На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . http://www NULL .huddletogether NULL .com/projects/lightbox2/images/image-1 NULL .jpg) (http://www NULL .huddletogether NULL .com/projects/lightbox2/images/image-2 NULL .jpg) . ... Tags: site lightbox . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>11) - geo.sai.msu.ru/ )

• Hello world! Лаборатория лазерной интерферометрии
• elstream.ru: онлайн видеотрансляции с Эльбруса Лаборатория лазерной
• Northern Lights over Norway Лаборатория лазерной интерферометрии