... What does people think about in my country? ... Some Situations are roots in communism, other are new situations created after 1990. ... In this very moment we have many private schools initiated and supported by many different ONG's. Changing the character of education . ... In Romania we need a different education system, one that is supported by society. ... The ramifications of educations system, based on the needs and the development of the economy as well as social and cultural life, go on. ...

Еще в разделе: (Показать все результаты (>99) - www.prof.msu.ru/ )

• Central Eurasian Studies Society Sixth Annual Conference (2005)
• CEP AN INTERNATIONAL EXCHANGE PROGRAM IN OMSK
• About the importance of founding teleecommunication centres in developing areas

... The fo llowing Sections and Subsect ions are to be held: The Russian Language (its history, etymology, dialectology, phonetics and phonology, lexicology and lexicography, morphology, syntax, language of fiction, speech and text, cognitive linguistics) Russian for Foreign Students (theory and methodology of teaching) Rhetoric General and Contrastive Linguist ics Theoretical and Applied Linguist ics Philo logy o f Slavonic Languages Classical ... Ivanov V.V. A greater and more profound work....

Еще в разделе: (Показать все результаты (>287) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.doc
• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.pdf
• http://www.philol.msu.ru/~kedr/kedr_editored.pdf

. Лаборатория биофизики клетки: Объявления о семинарах и др. / . comments . Правка . Недавние изменения . Настройки . RSS Atom . Comments in the moderation queue : 1 . Recent comments on posts in the blog : . RSS Atom . Ссылки: sidebar . Редактировалось в последний раз Sun Oct 11 21:47:07 2015

Еще в разделе: (Показать все результаты (>29) - cell.biophys.msu.ru/ )

• Лаборатория биофизики клетки: Объявления о семинарах и др.
• seminar-03.12.2015
• seminar-14.04.2015

Space Weather . ... Space weather . ... Data . ... You should fill in "Workspace" by groups of data sets to create plots. ... Putting different kind of data into the same plot remember, that the first dropped data set chooses and determines the axis scale for all data. ... If you need both kind of scale in the same plot, create two different plots and unite them. The speed of this service depends on 3 components: data processing on server, data transmission and data plotting in your browser. ...

Еще в разделе: (Показать все результаты (>4) - swx.sinp.msu.ru/ )

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>82) - www.intsys.msu.ru/ )

• Интеллектуальные системы :: Сотрудники :: Гасанов Эльяр Эльдарович :: Instantly
• Microphone Setup Module
• Training

О факультете . ... Психологи МГУ . ... История факультета . Награды факультета . ... Руководство факультета . ... Совет по психологии УМО университетов РФ . ... Фотографии факультета . ... Правила приема на факультет психологии МГУ . ... Подготовительное отделение . ... Лекции гостей факультета . ... Клуб выпускников факультета психологии МГУ . ... Факультет психологии Московского государственного университета им. М.В. Ломоносова . ... Дизайн и поддержка сайта 1997-2016: Станислав Козловский . ...

Еще в разделе: (Показать все результаты (>153) - www.psy.msu.ru/ )

... Conferences . M.V.Lomonosov Moscow State University . Faculty of Mechanics and Mathematics . ... Moscow State University . 119991 Moscow RUSSIA . ... Contact: room A1620, Moscow State University main building . ... Our " Conferences " section has been updated . ...

Еще в разделе: (Показать все результаты (>183) - higeom.math.msu.su/ )

• Students (English)

... Master Education . ... Master programs . ... graduates for activities requiring in-depth fundamental and professional knowledge, including research in applied mathematics and computer technology, development and use of mathematical models for processes and objects, development and application of advanced mathematical methods and software to address problems in science, technology, economics and management.The Mathematical and Computational Methods of Image Processing ... master thesis...

Еще в разделе: (Показать все результаты (>49) - hcs.cmc.msu.ru/ )

• Master programљ"Decision Engineering in Economics and Finance" | Магистерское и
• Master program "Information Security and Cryptography" | Магистерское и
• Master program "Software for Computer Networks" | Магистерское и послевузовское

DVM-system of parallel program development . Installation guide . ... 1 DVM-system installation under Windows95/NT . ... Microsoft Visual C++ 5.0 version and later (4.0 version can be used with some restrictions, see below); . ... Now the user should copy all files from directory dvm_sys/user to his own directory with DVM programs. ... In this case (but if DVM-system installation was succesfully verified) the user should keep above files with errors and ask for system programmer support. ...

Еще в разделе: (Показать все результаты (>127) - sp.cs.msu.ru/ )

• DVM-system. Installation guide. Version 3.60
• DVM-system. Installation guide. Version 3.82
• DVM-system. Installation guide. Version 3.30

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>16) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Copyrightї1997 Bob Yen (byen@ix.netcom.com) (http://www.comet-track.com/hb/hb.html) . ... Information on Comet Hale-Bopp for the Non-Astronomer Hale-Bopp rotates about twice a day (3/14/97) . ... The Comet Observation Home Page was been selected to receive the Griffith Observatory Star Award for the week of February 2 - 8, 1997 for excellence in promoting astronomy to the public through the World Wide Web. ... Typically, about 1,000 individual users/computers access this page every day. ...

Еще в разделе: (Показать все результаты (>15) - www.issp.ac.ru/ )

. Frames are requied

99. http://phys.msu.su/upload/iblock/941/gp2012appform.doc

100. MSU Science Park - About us