MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>11) - www.sciencepark.ru/ )

• MSU Science Park - News
• MSU Science Park - Venue & Space

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>115) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee service

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>89) - imaging.cmc.msu.ru/ )

• Ringing analysis | Laboratory of Mathematical Methods of Image Processing

Thursday, June 24th, 2010 . ... Wednesday, June 16th, 2010 . На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . ... You are currently browsing the Лаборатория лазерной интерферометрии blog archives for June, 2010. ... Наши публикации . ... Публикации за 2011 . Публикации за 2012 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>4) - geo.sai.msu.ru/ )

• Lightbox 2 Лаборатория лазерной интерферометрии
• site lightbox Лаборатория лазерной интерферометрии
• Uncategorized Лаборатория лазерной интерферометрии

ChangeLog for snakes # # Generated by Trac 0.12.5 # 04/11/16 22:55:00 Mon, 20 Dec 2010 14:01:39 GMT Daniil Alexeyevsky me.dendik@тАж [134:8e75e931bfd2] * snakes / example.snake ( modified ) example.snake : better rules for chasing enemy tail Mon, 20 Dec 2010 11:57:44 GMT Daniil Alexeyevsky me.dendik@тАж [121:06e4b4ea7596] * snakes / example.snake ( modified ) * ...

Еще в разделе: (Показать все результаты (>383) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=360c297c05f3577ca730ecaf86131163456f6b73&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=138%3A416418c9aaef&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=416418c9aaefbd75f3451a63f12d0ab8af3b89f3&limit=100&mode=stop_on_copy

... importance of terms such as 'geosols', 'paleosols' etc with interest. ... new zealand perspective is similar to that of Dr Crook of Australia - the . ... Some Quaternarists in New Zealand use 'buried soil' instead of buried . paleosol and the distinction is one of preference in the end (e.g Almond . ... I use the simple definition of a paleosol as a soil of a past landscape or . ... paleosols, and exhumed paleosols. ... surface' or 'non-buried' paleosols because these soils are clearly in the . ...

Еще в разделе: (Показать все результаты (>127) - www.fadr.msu.ru/ )

• Abstracts
• REPORT ON INTERNATIONAL SOIL SCIENCE CONGRESS (Montpellier, France, August...
• Foundation for Agrarian Development Research - History - 1998

. Moscow State University . INTERNATIONAL CONFERENCE . H YDRODYNAMIC I NSTABILITY AND T URBULENCE . February 24 ? March 02 , 2008 . Moscow, Russia . Call For Papers Информационное письмо . Author instructions . Abstract example Paper example . Location (More information) . Conference Program Posters . E-mail : gertsens@imec.msu.ru . Institute of Mechanics, Lomonosov Moscow State University . Aerodynamical Installations . Moscow Sights & Attractions

Еще в разделе: (Показать все результаты (>11) - hit-conf.imec.msu.ru/ )

... http :// www.gpgpu.org / - пожалуй, самый популярный сайт по тематике ОВГПУ. http ://developer. nvidia .com/page/home.html - портал компании NVidia для тех, кто работает с их графическими процессорами. http ://www. nvidia .com/object/ cuda _get.html - страничка технологии NVidia CUDA . http :// ati.amd.com /developer/ index.html - портал компании Лаборатория Параллельных информационных технологий НИВЦ МГУ . ...

Еще в разделе: (Показать все результаты (>2) - gpu.parallel.ru/ )

Название статьи И.О. Фамилия11,a, И.О. Фамилия22,b 1 Название института и полный адрес, например: Московский государственный университет имени М.В.Ломоносова, физический факультет, кафедра общей физики. ... Title in English I.O. Pervyiavtor1,a , I.O. Vtoroiavtor2,b 1 Название института и адрес на английском языке, например: Department of [.. ... Moscow 119991, Russia. 2 Название института и адрес на английском языке, например Sternberg State Institute of Astronomy, Moscow State University. ...

90. XAFS Publication Database search form

91. http://qfthep.sinp.msu.ru/talks2011/berezhnoy_qfthep2011.pdf

92. Quantum Information Lab, Int'l Laser Ctr. and Faculty of Physics, M.V.Lomonosov

93. Лаборатория Физико-химической газодинамики

94. http://geo.web.ru/conf/alkaline/2009/Syomka.htm

95. MSU-LGCLL:: Papers submitted to QUALICO-94

96. http://qi.phys.msu.ru/papers/2010-nphoton-4-585.pdf

97. DreamSpark Premium на Химическом факультете МГУ