... Студенческая Астрономическая обсерватория ГАИШ . ... Структура ГАИШ : Отдел внегалактической астрономии : . ... For those really interested in galaxies, extragalactic astronomy or the aspects of cosmology we study, we can always find an interesting problem to work on. ... To make your work in the Group most effective, it would be useful to study the following courses read by our group members as well as the members of other groups in our and other institures. ... Student information . ...

Еще в разделе: (Показать все результаты (>13) - www.sai.msu.ru/ )

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>10) - hcs.cmc.msu.ru/ )

• Mathematical Models of Complex Systems: Theory, Algorithms, Applications |

... There is a serious question in Congress' agenda - strategy of Higher School development, and certainly, vital problems of your institutions, especially actual in the current economic situation. ... A month ago, I have given several commissions, aimed to support Russian students, the system of higher professional education and job placement of graduates. ... I would like to mention that legal requirements to establish Federal and national research universities are formulated now. ...

Еще в разделе: (Показать все результаты (>24) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/94.doc

... Cell Bio/., ... The mean length of microtubules surrounding the centrosome in different cell lines differed insignificantly and equalled 0.4-0.8 µm. In this case, the microtubules attached to the centrosome were on the average slightly shorter than the free ones. ... Histogram of microtubule distribution by length around the centrosome in cells. radiating outward from the cell center also does not exceed 2 µm. Short microtubules are prevalent: those of 0.2-0.4 µm make up 34% of attached ones. ...

Еще в разделе: (Показать все результаты (>22) - cellmotility.genebee.msu.ru/ )

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>7) - www.pereplet.ru/ )

... DYNAMIC OF RHEOLOGICALY STRATIFIED LITHOSPHERE UNDER CONTINENTAL COLLISION. Electronic version of Ph.D. thesis . ... Purpose of work - constructing of quantitative model of mechanical and thermal processes occurring in the lithosphere, having simplified 3-layers construction (rigid upper, plastic lower crust, rigid mantle lithosphere), under continental collision. ... Stress t xz and strain rate in lower crust, calculated from model M1. a)5 m.y.; b)20 m.y. from the beginning of collision. ...

Еще в разделе: (Показать все результаты (>16) - dynamo.geol.msu.ru/ )

• Summaries of articles

... Scientific laboratories . ... Head of the laboratory: Gorkov Valery, Senior Research Fellow, PhD Contact information . ... loz@cmc.msu.ru . ... 119991, Moscow, GSP-1, Leninskiye Gory, MSU, 2nd Educational Building, CMC Faculty, rooms 719 (Head of the laboratory), 720, 729 . ... The Laboratory of Inverse Problems was established in 1996 through integration of two laboratories: the lab of Mathematical methods of structural analysis and the lab of Methods for automation of an experiment. ...

Еще в разделе: (Показать все результаты (>157) - en.cs.msu.ru/ )

• Send by email | CMC MSU

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>113) - www.genebee.msu.ru/ )

• Genebee ClustalW 1.83 Help
• AliComp - GeneBee Alignments Comparison - Advanced
• Notes on searching by similarity

... Probable participation of 14-3-3 in tau protein oligomerization and aggregation. ... This review is focused on universal adapter proteins 14-3-3 that seem to be significant partners to tau protein in neurons. 14-3-3 interacts with nonphosphorylated tau and promotes its interaction with and phosphorylation by a number of protein kinases. 14-3-3 induces aggregation of nonphosphorylated tau and does not affect aggregation of tau phosphorylated at specific sites. ...

Еще в разделе: (Показать все результаты (>23) - biochem.bio.msu.ru/ )

• The effects of endogenous non-peptide molecule isatin and hydrogen peroxide on
• [The use of immobilized ubiquitin for biosensor analysis of the mitochondrial

Three-waves interactions of surface defect-deformational waves and their role in selforganization of micro- and nanostructures under laser action on solids Diploma thesis abstract Selforganization of nano and microstrutures of the surface relief under the action of external energy (laser and ion) beams is considered as an instability of quasistatic surface defectdeformational (DD) waves formed by coupled quasistatic Lamb and Rayleigh acoustic waves and defect concentration waves. ...

Еще в разделе: (Показать все результаты (>66) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2010/Shtokolov_Pelivanov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2016/Kekkonen_Konovko_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2006/Bogdanov_Molotkov_en.pdf

Avoiding Boosting Overfitting by Removing Confusing Samples Alexander Vezhnevets, Olga Barinova Moscow State University, dept. of Computational Mathematics and Cybernetics, Graphics and Media Lab 119992 Moscow, Russia {avezhnevets, obarinova}@graphics.cs.msu.ru Abstract. ... We propose an algorithm for removing confusing samples and experimentally study behavior of AdaBoost trained on the resulting data sets. ... In section 4. we describe an algorithm for removing confusing samples from training set. ...

Еще в разделе: (Показать все результаты (>117) - graphics.cs.msu.ru/ )

• GML Texturizer Tutorial | Лаборатория компьютерной графики и мультимедиа
• GML Texturizer Tutorial | Graphics and Media Lab
• Saliency Map Estimation | Graphics and Media Lab

... В работе рассматривается двухмерная математическая модель лесных пожаров, приводится алгоритм численного решения и результаты тестовых расчетов. ... В работе [1] была предложена двухмерная модель лесных пожаров, построенная методом осреднения исходных трехмерных уравнений газовой динамики по высоте слоя лесных горючих материалов, который рассматривается как одноярусная двухфазная (газовая и твердая фазы) двухтемпературная реакционноспособная среда. ... Газовая фаза: . ... коэффициент диффузии, . ...

Еще в разделе: (Показать все результаты (>23) - www.library.biophys.msu.ru/ )

... Полная версия этой страницы: Barclays Capital 2009 . Студенческий форум Физфака МГУ > Общий > Работа . ... 19.8.2009, 14:08 . Barclays Capital is the investment banking division of Barclays Bank PLC, offering strategic advisory, financing and risk management solutions to large corporate, government and institutional clients. ... To register for the event, please apply online at www.barcap.com/expectexcellence and select 'Moscow' as the location in your application. ...

Еще в разделе: (Показать все результаты (>141) - wasp.phys.msu.ru/ )

• Barclays Capital 2009 - Студенческий форум Физфака МГУ
• Студенческий форум Физфака МГУ > Строчки из песен
• Студенческий форум Физфака МГУ > феноменальное видео ! (знающим английский...

Journal of Experimental and Theoretical Physics, Vol. ... MISCELLANEOUS Biphotons as Three-Level Systems: Transformation and Measurement L. A. Krivitskioe, S. P. Kulik*, A. N. Penin, and M.V. Chekhova Moscow State University, Vorob'evy gory, Moscow, 119992 Russia *e-mail: skulik@qopt.phys.msu.su Received April 28, 2003 Abstract--Two algorithms for measuring the polarization state of the biphoton field prepared in the form of a three-level system (qutrit) are considered. ...

Еще в разделе: (Показать все результаты (>82) - qi.phys.msu.ru/ )

• http://qi.phys.msu.ru/papers/2009-jetp(e)-108-33.pdf
• http://qi.phys.msu.su/papers/2007-os(e)-103-107.pdf
• http://qi.phys.msu.ru/kulik/Papers/pR37_1.pdf

Lomonosov project . ... Mikhail Lomonosov . ... The studies of Lomonosov determined profile of Russian science forever, and we appreciate the discoveries of the leading Russian scientists as the studies of his direct learners and successors. A recognized and the most significant input of Lomonosov into natural science is molecular-kinetic theory of heat, developed during the prevalence of theory of specific fiery matter ? ... Lomonosov?s theory drawn wide response in European science. ... Aurora. ...

Еще в разделе: (Показать все результаты (>4) - lomonosov.sinp.msu.ru/ )

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD Dmitry N. Dirin . ... Cadmium chalcogenide colloidal quantum dots (semiconductor nanocrystals). Electronic and optical properties of quantum dots. ... Semiconductor nanoheterostructures. ... Grant UMNIK-2008 "Development of prototype of the solar cell photosensitive element based on CdTe/CdSe colloidal quantum dots". ... 2008-2014 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>13) - www.lssm.inorg.chem.msu.ru/ )

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>2) - physcontrol.phys.msu.ru/ )

• List All Categories

... Living systems depository "Noah's Ark" . ... About the project . ... The project of the Moscow State University "Noah's Ark" is dedicated to the creation of multi-functional network storage of biological material. ... Creation of temporary prototypes of living systems depository bank for storage and research of the collected material. ... Development of algorithms for the information processes analysis in living systems for receiving, filing and processing of various types of biological data. ...

Еще в разделе: (Показать все результаты (>2) - depository.msu.ru/ )

... New carriers in sorption-catalytic analysis . ... Search for and molecular design of metallated and organoelement receptors for the rcovery and determination of organic compounds . ... Electrokinetic ion chromatography - novel method for separation and determination of simple and complex cations and anions . ... Development of the principles of analytical methods of separation and preconcentration and use of these methods in environmental analysis . ... Novel ion-exchange HPLC materials . ...

Еще в разделе: (Показать все результаты (>23) - analyt.chem.msu.ru/ )

Backlinks to WikiGroups in all Webs ( Search Main Web only ) . ... Administrator Group * Member list (comma separated list): * Set GROUP = RomanKondakov * Persons/group who can change the list: * Set ALLOWTOPICCHANGE ... r2 - 22 Aug 2009 - 23:36 by AdminUser . ... NEW - 09 Jan 2009 - 12:00 by ProjectContributor . ... GroupViewTemplate . ... PracticumVGroup * Member list (comma separated list): * Set GROUP = Main.RomanKondakov Main.МихаилВасильевич * Persons/group who can change the list: .. ...

Еще в разделе: (Показать все результаты (>1648) - wiki.cs.msu.ru/ )

• (backlinks in Main Web) WikiGroups < Main < Foswiki
• (backlinks in System Web) VarWIKINAME < System < Foswiki
• (backlinks in Main Web) DontsovEvgeny < Main < Foswiki