sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>1751) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>4) - www.ecocoop.ru/ )

... Ekaterinburg department of the Association " Professionals for Cooperation" is announcing the conference of USIS Educational Programs Alumni which will be held in Ekaterinburg on October 19-21, 2000 in the House of Actor. At the end of the XX century and on the eve of the III millennium Russia found itself at the crossroads: good intentions of building a democratic state with civic liberties and market economy turned out to be largely unsuccessful and unrealistic. ... Conference Board: . ...

Еще в разделе: (Показать все результаты (>119) - www.prof.msu.ru/ )

• WHICH UNIVERSITY SYSTEM IS BEST?
• Short meetings in the States

. Microtubule network was disrupted by nocodazole treatment (A). Then cells incubated in free of nocodazole media and fixed after 2 (B), 4 (C), 6 (D), 8 (E) and 10 (F) minutes. Cells were immunostained against beta-tubuline. Some microtubules polyimerized on the centrosome but the majority was born in the cytoplasm. bar=10 .

Еще в разделе: (Показать все результаты (>32) - cellmotility.genebee.msu.ru/ )

... Contact information . ... microsoft.cs.msu.su . ... Our goal is to provide researchers from many branches of science, education and industry with innovative tools and methods for solving applied problems using the latest information technologies, modern methods of computation modeling and scientific visualization. ... FetchClimate is deployed as a Windows Azure cloud service. ... The uncertainty can be used in further uncertainty estimation of a computational model that uses FetchClimate. ...

Еще в разделе: (Показать все результаты (>157) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics
• Computer Graphics and Multimedia Lab
• Computer Graphics and Multimedia Lab | CMC MSU

... In recent years among methods for analysis of a genomic data, more interest is attracted to alignment-free methods for comparing samples based on work with k-mers (oligonucleotides of length k, also called l-tuples or n-grams) directly from metagenomic reads. ... 2012) A metagenome-wide association study of gut microbiota in type 2 diabetes, Nature, 7418: 55­60. ... 2010) A human gut microbial gene catalogue established by metagenomic sequencing, Nature, 7285: 59-65. ...

Еще в разделе: (Показать все результаты (>238) - mccmb.belozersky.msu.ru/ )

• MCCMB'15
• MCCMB'13
• MSU campus map

... Презентация по машинному переводу от Google на коллоквиуме по базам данных в МГУ . 2-го июня в 11:00 во 2-м учебном корпусе МГУ (здание факультета ВМиК МГУ) состоится презентация исследователя из Нью-Йоркского отделения Google на тему: "Building a Large-Scale Machine Translation System" ("Построение масштабируемой системы машинного перевода"). ... Презентация проводится на английском языке; аннотация презентации и информация о докладчике представлена ниже: . ... 2003 2011 MsuNews.Ru Новости МГУ . ...

Еще в разделе: (Показать все результаты (>45) - www.msunews.ru/ )

... Faculty of Physics . ... MSU Physicists (Prof. V.S. Chernysh, Dr. A.E. Ieshkin, Faculty of Physics, and Senior Researcher Yu.A. Ermakov, Scobeltsyn Nuclear Physics Research Institute, MSU) discovered a new mechanism of sputtering with cluster ion beams. A cluster is an assembly of atoms or molecules which quantity is in range from a few up to a few tens of thousands units per cluster. ... Recent decades, interaction of cluster ions with solids has been under extensive investigation. ...

Еще в разделе: (Показать все результаты (>114) - phys.msu.ru/ )

• Сотрудники физического факультета МГУ

Irina IVANOVA Transformation of the Southeast Asian social and economic space in the process of integration of the region into the global information economy Introduction. ... Common problems are superconcentration of economic activity in overpopulated centers, poor transport access to peripheries and lack of national and global connectivity. ... The nodes of the spatial framework of the Malacca Strait economic region have hierarchical structure as global, regional, national centers (pic.6). ...

Еще в разделе: (Показать все результаты (>315) - www.geogr.msu.ru/ )

• CONTENTS ? 4 - 2013
• wnsvnttw iybtwjfpGS (все сообщения)
• Фотогалерея

... This is my main interest in linguistics that I have been pursuing for a number of years. ... Spoken language . Present-day linguistics is primarily oriented towards written language. ... I am personally interested in the latter kind of research since I prefer to use first-hand knowledge rather that crucially rely on how other people interpret languages (or still other people?s writings). ... This is one of the major languages of Russia spoken by dozens of thousands of people. ...

Еще в разделе: (Показать все результаты (>284) - www.philol.msu.ru/ )

• MSCL-3 | Practical Information

... The intensity of neutral beams generated from various shapes of nozzles was measured and the orifice diameter of skimmer was adjusted. ... The ratio of monomer ion in the beam was 58%. ... Results and discussion Fig. 2 shows the skimmer diameter dependence of neutral beam intensity from the metal nozzles B and C. The source gas was Ar. ... Conclusion In order to get high intensity of neutral cluster beam, new metal nozzles were constructed and orifice diameter of skimmer was adjusted to beam...

Еще в разделе: (Показать все результаты (>108) - danp.sinp.msu.ru/ )

• Статьи, подготовленные для публикации в журнале Nuclear Instruments and Methods

... 2015 . ... Senior lecturer, School of Public Administration, Lomonosov Moscow State University. ... The article analyzers the public large-scale business support measures implemented by the Russian Government during the global financial crisis. The author estimates the effectiveness of this measure and analyzes the current state and dynamics of Russian businesses which received the government relief packages during the crisis (on the example of the metallurgy industry). ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>569) - ee-journal.spa.msu.ru/ )

... Class . ... METHOD . ... ucar.netcdf.AbstractNetcdf | ucar.netcdf.RemoteNetcdf . ... public class RemoteNetcdf . ... A concrete implementation of the Netcdf interface, this class uses java rmi to access a remote Netcdf. ... RemoteNetcdf (java.lang.String remoteHostName, java.lang.String dataSetName) . Open up a remote Netcdf by name. ... Methods inherited from class ucar.netcdf. ... Constructor Detail public RemoteNetcdf ( NetcdfRemoteProxy remote) throws java.rmi.RemoteException . ...

Еще в разделе: (Показать все результаты (>182) - angel.cs.msu.su/ )

• : Class NetcdfFile
• NormalizeBGDialog
• FourierNFDialog

яЛП . id #416 . Structural Design of Tall Buildings [not defined] . Common information . Periodicy: . [no information] . Impact-Factor: . [no information] . ISSN: . 1099-1794 . In print: . since 1997-01-01 till 2002-12-31 . Language: . en . Price: . single article - $1 . Classifier: . [no at all] . Comment: . From 2003: The Structural Design of Tall and Special Buildings . Published by . (4) . Wiley Interscience - roboUpdate . No homepage defined . No open resources defined . Close . Complain . Edit

Еще в разделе: (Показать все результаты (>1271) - journals.genebee.msu.ru/ )

... О UNИX . ... HelpOnXapian . Неизменяемая страница . ... Re-)Building an index . ... Using Xapian you can dramatically improve the performance of searching in moin and furthermore unlock some more features (see the search prefixes above) not possible with the legacy search engine. ... To process attachment files, moin uses filter plugins - here is the list of filter plugins included: . ... Moin will auto disable xapian_search (and fall back to slow search) if it doesn't find a usable index. ...

Еще в разделе: (Показать все результаты (>203) - uneex.mithril.cs.msu.su/ )

• Index of /static/AltDocs_informatika1/Book1/4_text/225_StarWriter/08_pictures
• LecturesCMC/Distro2006/05_Building - UNИX
• HelpOnNotification - UNИX

Борис Михайлович Болотовский (ФИАН) . ... автор книги "Оливер Хевисайд" (см. сайт изд. ... Оливер Хевисайд (1850 - 1925), закончил только неполную среднюю школу, дальнейшие знания получил самостоятельно, путем самообразования. ... Предсказал что в верхних слоях атмосферы существует слой (слой Хевисайда), отражающий электромагнитные волны. ... Аудио запись доклада Б.М. Болотовского ( 58 мин, mp3, 80MB ). ... Б.М. Болотовский начал свой доклад . ... Продолжение доклада. ...

Еще в разделе: (Показать все результаты (>9) - lve.sinp.msu.ru/ )

• All Gell-Mann_Sep25_2007 pictures
• Lubyanka_after_Mar29_2010 pictures
• All Piter_Oct-2010 pictures

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>62) - scon155.phys.msu.su/ )

• Off-center impurities
• Theory of electronic properties of disordered semiconductors and systems with
• Off-centering of Pb and Sn impurities in GeTe induced by strong local stress

... TreeTop - Phylogenetic Tree Prediction . The source sequence multiple alignment could be formed from low and upper case letters. Upper case letters will show that there is a homology between correspondent fragments in alignment. ... Tree and Picture Options . Extra tree format . None Phylip Phylip (multiline) Nexus Nexus (TREES block only) Hennig86 . ... None Slanted Slanted 2 Rectangular Rectangular 2 Phylogram Unrooted Unrooted 2 . ... Alignment . Alignment example: . ...

Еще в разделе: (Показать все результаты (>145) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• AliGraf - GeneBee Graphical Alignment Help
• MUSCLE User Guide

Projects . ... SmpB . During trans- translation, stalled bacterial ribosomes are rescued by small protein B ( SmpB ) and by transfer-messenger RNA (tmRNA). ... We present evidences that SmpB binds the large and small ribosomal subunits in vivo and in vitro . ... SmpB contacts the large subunit transiently and early during the trans -translational process. The affinity of SmpB for the two ribosomal subunits is modulated by tmRNA in the course of trans -translation. ...

Еще в разделе: (Показать все результаты (>36839) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% ( vs. 1) - TWiki
• SmpB - Projects - TWiki - (printable)
• TWikiTip009 - TWiki - TWiki

. The algorithm builds multiple alignment of conservative blocks and find consistent sets of helices. The input data may contain junk sequences. Department of Department of Bioengineering and Bioinformatics, MSU, Moscow, Russia . Mail to Andrey Mironov .

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPsite - Algorithm Format requirements