... X-COM: Distributed Computing Software . ... The idea of distributed computing, or metacomputing, is to combine available computational resources for different applications processing. ... For these applications we simultaneously used high-performance computational resources of Moscow State University and Russian Academy of Sciences, computing centers of Saint Petersburg, Novosibirsk, Chelyabinsk, Ufa, Tomsk, etc. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>37) - hpc.msu.ru/ )

• APPLICATIONS: Theoretical Physics | Moscow University Supercomputing Center
• Distributed Modular Monitoring System: a New Approach to Supercomputer
• APPLICATIONS: Astronomy | Moscow University Supercomputing Center

... An event inexplicable by the laws of nature; a miracle. ... A good title for the workshop Ї Dark matter came as a surprise, Ї A strong emotion is associated with the awareness that we seem to know the basic laws of nature but we still miss... what is the universe made of.. Raises doubts on our understanding of early universe Ї Its discovery may need a monumental effort Ї BUT, hopefully it CAN be explained by the laws of nature Progress on DM Ї Evidence from Dama/Lybra .. ...

Еще в разделе: (Показать все результаты (>150) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/Ilina.pdf
• http://nuclphys.sinp.msu.ru/school/s08/s08_47.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/Petrushanko.pdf

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... 2009 Simulation of snow water equivalent by mathematical models of different complexity . Holko L. , Sokratov S.A. , Shmakin A.B. , Kostka Z. в журнале Материалы гляциологических исследований , ? ... 2007 Snow and landscape: Multi-scale and multi-disciplinary aspects of snow . ...

Еще в разделе: (Показать все результаты (>1127) - istina.msu.ru/ )

• Optica Pura y Aplicada - журнал | ИСТИНА - Интеллектуальная Система
• Shakina Y.N. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Bolychevtseva Yu V. - сотрудник | ИСТИНА - Интеллектуальная Система

INNER POLAR RINGS REGULAR LENTICULAR GALAXIES 1 K. Sil'chenko 2 Sternberg Astronomical Institute, 119992 Moscow, Russia; Isaac Newton Institute Chile, Moscow Branch; olga@sai.msu.su Afanasiev Special Astrophysical Observatory, 369167 Nizhnij Arkhyz, Russia; vafan@sao.ru Received 2003 December accepted February 4 ABSTRACT have investigated a sample of galaxies, mostly with circumnuclear dust lanes orthogonal their major axes, chosen from Hubble Space Telescope Wide Field Planetary Camera 2 images. ...

Еще в разделе: (Показать все результаты (>49) - sn.sai.msu.ru/ )

• http://sn.sai.msu.ru/~sil/preprints/204780.pdf
• http://sn.sai.msu.ru/~sil/preprints/leo3.pdf
• http://sn.sai.msu.ru/~sil/preprints/al534.pdf

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>158) - www.pereplet.ru/ )

... A new mechanical model of parametrically excited pendulum is proposed. ... Schemes of equivalent parametric pendula We consider the pendulum presented in Fig. 1 which is governed by the same dimensionless equation as the pendulum with vertically vibrating pivot in Fig. 2, see [1, 2] and references therein. ... Stability of inverted position As we see in Fig. 3 (for q < 0 see also Fig. 7) the inverted vertical position, = , see Figs. 5 and 6, can be not only stabilized but also destabilized by...

Еще в разделе: (Показать все результаты (>9) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/ENOC2014Presentation.pdf

... Monitoring of relativistic electron fluxes in the near-Earth space. Development of the methods for studying of relativistic electrons of fluxes in the regions of precipitation. Studies of the fluxes and spectra of high-energy electrons of the outer radiation belt of the Earth. ... Studies of the fluxes and spectra of high-energy electrons in the low-latitudinal regions (at small L). ... Studies of VLF electromagnetic radiation generated during the main phase of the lightning discharge. ...

Еще в разделе: (Показать все результаты (>2) - vernov-relec.sinp.msu.ru/ )

Each topic can have one or more files of any type attached to it by using the Attach screen to upload (or download) files from your local PC. Attachments are stored under revision control: uploads are automatically backed up; all previous versions of a modified file can be retrieved. ... Attachment names are stored directly in the server native file system, so filenames are sanitized to prevent use of names that would be unacceptable to the variety of platforms where Foswiki is supported. ...

Еще в разделе: (Показать все результаты (>1855) - wiki.cs.msu.ru/ )

• PatternSkinCssCookbook < System < Foswiki
• (backlinks in System Web) VarATTACHURL < System < Foswiki

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>124) - www.genebee.msu.ru/ )

• BioSystems, 30 (1993) 57-63 57
• Notes on searching by similarity
• BLAST Basic Overview

Theory as a Lighthouse in the Electrochemical Ocean . In memory of Alexander M. Kuznetsov . ... Until his last days he continued to work on various aspects of charge transfer phenomena. ... In electrochemical kinetics the theory always outruns the experiment, and the quantum mechanical theory of charge transfer created in the famous Theoretical Department of the Frumkin Institute in Moscow (R.R. Dogonadze, A.M. Kuznetsov and co-authors) is a good example for that. ...

Еще в разделе: (Показать все результаты (>59) - electr003.chem.msu.ru/ )

• Electrocatalytic effects in gas sensors based on low-temperature superprotonics
• Vladimir Sergeevich Bagotsky
• Oleg A. Petrii

... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... The Faculty of Geography supports student exchange programmes with several universities and research centers abroad. ... Another aspect of international activity of the Faculty is the participation in international grants of the Russian Foundation for Basic Research. ... An access of our scientists to the international scientific magazines promotes the expansion of Russian science in the world. ...

Еще в разделе: (Показать все результаты (>43) - eng.geogr.msu.ru/ )

• Department of Cryolithology and Glaciology

... Maxim Libanov 3 Families In 4D From 1 Family In 6D Nielsen-Olesen vortex: Ug(1) gauge eld A+scalar 2 Our 3D World is a core of AbrikosovCore of the vortex -Our 3D World There is only single vector-like fermionic r generation in 6D Chiral fermionic zero modes are trapped in the core due to speci c interaction with the A and . Speci c choise of Ug(1) fermionic gauge charges Number of zero modes = 3 Zero modes 4D fermionic families Why Neutrinos Are Different? ... Maxim Libanov Neutrinos masses. ...

Еще в разделе: (Показать все результаты (>129) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2013/HiggsTalk_FINAL4.pdf
• http://qfthep.sinp.msu.ru/talks/ginzbbdark100912.pdf
• http://qfthep.sinp.msu.ru/talks2011/qfthep2011_popov_v3.pdf

First Announcement Call for Papers THE CASPIAN REGION: ENVIRONMENTAL CONSEQUENCES OF THE CLIMATE CHANGE October 14-16, 2010 Moscow , Russia Organized by Faculty of Geography, M.V. Lomonosov Moscow State University INTRODUCTION The purpose of the Conference is to bring together researchers from different countries with experience in the Caspian area for exchange of data, results and ideas on environmental consequences of the climate ...

Еще в разделе: (Показать все результаты (>258) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/cafedra/meteo/uchd/diplom/kursovye-2014-kurs3.doc
• CONTENTS ?6 - 2010
• bbpgp

... Математический семинар глобус, заседание 26 апреля 2005 г. Во вторник, 26 апреля 2005 года, в 15:40 в конференц-зале НМУ, Б. Власьевский, 11 состоится доклад Games in computer science: a survey . ... In this talk, we shall survey different uses of games in computer science, which split roughly along issues of provability versus proofs. ... As for proofs , the emphasis is on the dynamics of strategies. Here, strategies are just another way of looking at proofs / programs / morphisms. ...

Еще в разделе: (Показать все результаты (>65) - www.mmonline.ru/ )

• MMOnline | Форумы | Преподаватели | Черный и матстат
• MMOnline | Форумы | Разное | О покупке компьютера

... Analysis of the Characteristics of Self Similarity of Seismicity and the Active Fault Network of Eurasia V. S. Zakharov Faculty of Geology, Moscow State University, Moscow, 119899 Russia e mail: vszakharov@yandex.ru; zakharov@dynamo.geol.msu.ru Received February 22, 2011 Abstract--An analysis of the possible relationship between fractal dimensions of the active fault network, spatial distribution of earthquake epicenters, and parameter b in the GutenbergґRichter law is presented. ...

Еще в разделе: (Показать все результаты (>23) - dynamo.geol.msu.ru/ )

• http://dynamo.geol.msu.ru/personal/vsz/papers/Zakharov_Simonov_2010_eng.pdf
• http://dynamo.geol.msu.ru/personal/vsz/papers/Zakharov_2011_1_eng.pdf
• V.Zakharov's Ph.D. thesis

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... The documentation in Russian. ... These systems contain millions lines of code, thousands - tens of thousands classes. Visualization could help programmer to better comprehend these large systems, to orientate between lot of objects of these systems, to analyze intricate structure of code and find required information. ... Doc3D: Система трехмерной визуализации архитектуры программных систем . ...

Еще в разделе: (Показать все результаты (>134) - graphics.cs.msu.ru/ )

• DOC3d: A 3d Documentations system for programming languages | Лаборатория
• Road monitoring | Graphics and Media Lab
• Road monitoring | Лаборатория компьютерной графики и мультимедиа

PRL 105, 016001 (2010) PHYSICAL REVIEW LET TE RS week ending 2 JULY 2010 Random- Roughness Hydrodynamic Boundary Conditions Christian Kunert,1 Jens Harting,2,1 and Olga I. Vinogradova 1 2 3,4 Institute for Computational Physics, University of ... published 30 June 2010) We report results of lattice Boltzmann simulations of a high-speed drainage of liquid films squeezed between a smooth sphere and a randomly rough plane ... Squares are the results measured for a rough wall ( М 4%, r М 10x). ...

Еще в разделе: (Показать все результаты (>29) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/pre2006e.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp2008.pdf
• http://nanofluidics.phys.msu.ru/paper/JCP2014.pdf

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>20) - observ.pereplet.ru/ )

... Геология >> Геотектоника | ... Добавить новое сообщение . ... Учебное пособие "Введение в тектонофизику". Гончаров М. А., Талицкий В. Г., Фролова Н. С. Ответ. ... Тезисы научной конференции ЛОМОНОСОВСКИЕ ЧТЕНИЯ, ноябрь 2011 года СЕКЦИЯ ГЕОЛОГИЯ: . ...

Еще в разделе: (Показать все результаты (>23) - phys.web.ru/ )

1) Soil Science Faculty, Moscow State University, Moscow 119899, Russia; . ... We assessed critical loads of acid deposition and their exceedance for forest soils in the European part of the former Soviet Union using a simple balance method and mapped them within 1.0° в 0.5° longitude per latitude grid cells. ... The uncertainty in the estimated critical load values can be rather large due to uncertainty in critical chemical values for the soil as for a receptor, assessment method and data. ...

Еще в разделе: (Показать все результаты (>20) - eco.soil.msu.ru/ )

• ASSESSMENT OF SOIL SUSTAINABILITY TO ACID DEPOSITION
• CLEANSOIL, An innovate method for the on-site remediation of polluted soil
• THEORETICAL PRINCIPLES AND METHODS OF REMEDIATION OF SOILS POLLUTED WITH HEAVY