Клуб выпускников МГУ (Московский Государственный Университет) . Amazing clips from BBC Documentary 'Planet Earth', Episode 'Mountains' . Music: Vangelis Stina Nordenstam - Ask The Mountains, Voices Album, 1995 . Here is the playlist with my 'Wonderful Chill Out Music': http://www.youtube.com/view_play_list .. ... Ask the mountains . ... Wonderful Chill Out Music - Ice Worlds [HD] . ... Wonderful Chill Out Music -- Elmara - Training [HD] . ... XIV - Ibiza Chill Out Music . ...

Еще в разделе: (Показать все результаты (>1869) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: GOOGLE РАЗРАБАТЫВАЕТ ТРЕХМЕРНЫЙ АНАТОМИЧЕСКИЙ АТЛАС,
• Клуб выпускников МГУ: Обсуждение материала "GOOGLE РАЗРАБАТЫВАЕТ ТРЕХМЕРНЫЙ
• Клуб выпускников МГУ: Лекарство, реально помогающее при болезни Альцгеймера,

Архитектура ЭВМ и язык ассемблера . Страница поддержки курса "Архитектура ЭВМ и язык ассемблера" для 1 потока . ... Ассемблер nasm . ... Материалы . ... Материалы лекций . ... Материалы факультатива . ... Программа курса . ... Компьютерные системы: архитектура и программирование. 1 издание . ... Итоги коллоквиума ?1 . ... Коллоквиум ?1 . ... Итоги экзамена и всего курса . ... Результаты коллоквиума ?1 . ... Сдача домашних заданий на сервере earth.ispras.ru . ...

Еще в разделе: (Показать все результаты (>3) - asmcourse.cs.msu.ru/ )

• vartan | Архитектура ЭВМ и язык ассемблера | Page 3

День Физика . ... Новости . ... Абитуриентам . ... Главная Новости Наука . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>11) - www.dubinushka.ru/ )

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>24) - eco.soil.msu.ru/ )

• Polluting metals in Russian terrestrial ecosystems: chemistry, dynamics, and

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>198) - monkey.belozersky.msu.ru/ )

• SCOP classification

... About hotel . ... Murmansk (in 1916-1917 - Romanov on Murman) - is the largest city in the world, which is situated behind the Arctic Circle. ... In the city there are two regional museums: Murmansk regional museum of local lore and Murmansk regional art museum in which very interesting expositions are exposed. ... The Chinese restaurant "Shanghai" invites guests to taste the dishes, cooked by professional Chinese cooks and to be convinced that Chinese cuisine is one of the best in the world. ...

Еще в разделе: (Показать все результаты (>5) - 69parallel.ru/ )

Gordov E.P., Fazliev A.Z., Lykosov V.N., Okladnikov I.G., Titov A.G. Development of a web-based information-computational infrastructure for the Siberia Integrated Study. In: 'Environmental Change in Siberia. Earth Observation, Field Studies and Modelling' (Advances in Global Change Research, v. 40), 2010, p. 233-252. ... Ключевые слова: Environmental monitoring and assessment, climate, information systems, meteorology, regional climate change ...

Еще в разделе: (Показать все результаты (>100) - srcc.msu.ru/ )

• D.Sokoloff, R.Arlt, D.Moss, S.H.Saar, I.Usoskin Sunspot cycles and Grand
• Laboratory of Informatics
• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo

... Dmitry Stepanovich (VIDEO of March 2011) . Olga Silchenko, a soloist of the Early Music Theatre . ... Anna and Olga Silchenko have presented the duets by Rubinstein and Chaikovsky (VIDEO) . ... Two Russian romances - duets by Olga Silchenko and Dmitry Stepanovich (VIDEO) . ... N. Rimsky-Korsakov "The Tsar's Bride", the duet of Lubasha and Gryaznoy - by Olga Silchenko and Dmitry Stepanovich (VIDEO) . ... Vivaldi "Magnificat", 6th part, duet by Anna and Olga Silchenko (VIDEO) . ... Olga Silchenko . ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>858) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

... 1998 1 : Defended the Doctorate Degree Thesis on "Models of Cosmic Ray Particle Fluxes (Development and Applications)". ... Space Weather . ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv. ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv.Space Res. ...

Еще в разделе: (Показать все результаты (>7) - srd.sinp.msu.ru/ )

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>39) - www.ecocoop.ru/ )

• For three and half years of activity the participants of Ecological Cooperation

... FFTW - Footnotes . The output for the multi-dimensional rfftw is a more-conventional array of fftw_complex values, but the format here permitted us greater efficiency in one dimension. ... Unless you use fftwnd to perform one-dimensional transforms, in which case the temporary storage required for in-place transforms is as big as the entire array.) ... The 1D transforms require much more communication. ... Any compiler that enforces this limitation doesn't deserve to link to FFTW. ... Центры . ...

Еще в разделе: (Показать все результаты (>282) - www.parallel.ru/ )

• Vector Processors: Historical Perspectives | PARALLEL.RU -

... file . ... file log . ... 1 Using library in-place . ... 18 NEWS file . ... 21 NEWS file contains news that are important to the library users, not to the . ... It must contain a word abot every change in any interfaces. ... 23 contain a word about bugfix, if that bugfix was important and could cause users . ... 26 The file grows upwards (like blog, so that all the most important things are at . ... 38 * change(!): critical library interface change . 39 * change: change in the library interface . ...

Еще в разделе: (Показать все результаты (>4968) - kodomo.fbb.msu.ru/ )

• allpy: README.devel annotate

... Research Centers . ... Search Faculties Staff . ... About the faculty / Virtual tour / Лекция Д-ра Йошийоки Канеда (Yoshiyuki Kaneda, Japan Agency for Marine-Earth Science and Technology), "Advanced real-time monitoring system and simulation researchers for earthquakes and tsunamis in Japan . Лекция Д-ра Йошийоки Канеда (Yoshiyuki Kaneda, Japan Agency for Marine-Earth Science and Technology), "Advanced real-time monitoring system and simulation researchers for earthquakes and tsunamis in Japan . ...

Еще в разделе: (Показать все результаты (>211) - phys.msu.ru/ )

• Title
• Публикации по истории факультета
• Задачи вступительных экзаменов

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>32) - seac47-2.phys.msu.ru/ )

• Pre-registration and abstract submission form

... Useful Information . ... Vestnik CIE (in Russian) . ... Information about Russia . ... With an area of 17,075,200 square kilometres, it is the largest country in the world by land mass, covering almost twice the territory of the next-largest country, Canada. ... Formerly the dominant republic of the Union of Soviet Socialist Republics (USSR), Russia is now an independent country and an influential member of the Commonwealth of Independent States, since the Union s dissolution in December 1991. ...

Еще в разделе: (Показать все результаты (>27) - www.cie.ru/ )

... dmitriev@cs.msu.su . ... The Laboratory was founded in 1982 on the basis of the team of researchers which come from the Research Computing Center (MSU) to the Faculty of Computational Mathematics and Cybernetics of the Moscow State University. ... The laboratory of Mathematical physics is principally oriented on the following areas of research: . ... Barashkov I.S., Dmitriev V.I. Modeling marine electromagnetic soundings by the reciprocity principle // Computational Mathematics and Modeling. ...

Еще в разделе: (Показать все результаты (>120) - en.cs.msu.ru/ )

• Laboratory of Mathematical Physics
• Department of Algorithmic Languages
• Department of Algorithmic Languages | CMC MSU

... Without increasing the speed .. Without using this method .. ... Without further mention . ... Cavitation-free flow . ... Continuous motion . ... Безразмерная константа (коэффициент) . Dimensionless constant (coefficient) . ... Dimensionless rate of flow . Dimensionless flow rate . ... Block column . ... Lateral boundary . ... Due to its simplicity, the class of problems to which collocation is easily applied is greater than for the Galerkin method . ... Large mass . ... Fast diffusion . ...

Еще в разделе: (Показать все результаты (>128) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/13.htm
• http://num-anal.srcc.msu.su/eng_math/redict/15.htm

... Ключевые слова: научно-церковная конференция ""Иисус Христос вчера и сегодня во веки Тот же": Христианство на пороге третьего тысячелетия" (Москва, 23-25 нояб. 1999 г.) ; история Русской Церкви (новейший период) . ... Журнал Московской Патриархии . ... 1 (ЖМП) . ... Ключевые слова: библиография, рецензии . ... Ключевые слова: библиография, рецензии ; библиотеки . ... Ключевые слова: библиография, рецензии ; Церкви Православные: Румынская ; периодика: "Румынская Православная Церковь" (Румыния) . ...

Еще в разделе: (Показать все результаты (>77) - www.srcc.msu.ru/ )

• http://www.srcc.msu.ru/bib_roc/bib/ItemsR29.htm

... Course "Computer Physics" for 1st and 2nd year students of Physics . ... The audience is 1st and 2nd year students of Physics. ... It consists of a short lecture course, seminars, and a large number of computer labs. ... 1985-1994 : Lectured a specialized course on "Computer Physics"for the 3rd year students of Physics, Department of Physics, and attendees of the continuing education department, International Laser Center of Moscow State University. ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>91) - qilab.phys.msu.ru/ )